Recombinant Mouse Alpha-enolase | MyBioSource MBS955655 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Alpha-enolase

catalog :

MBS955655

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS955655

products type :

Recombinant Protein

products full name :

Recombinant Mouse Alpha-enolase

products short name :

Alpha-enolase

products name syn :

2-phospho-D-glycerate hydro-lyase; Enolase 1; Non-neural enolase; NNE

other names :

enolase 1B, retrotransposed; Alpha-enolase; enolase 1B, retrotransposed; enolase 1B, retrotransposed; 2-phospho-D-glycerate hydro-lyase; Enolase 1; Non-neural enolase; NNE

products gene name :

Eno1

other gene names :

Eno1b; Eno1; Eno1; Gm5506; EG433182; Eno-1; NNE

uniprot entry name :

ENOA_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-433

sequence length :

434

sequence :

SILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGAS
TGIYEALELRDNDKTRFMGKGVSQAVEHINKTIAPALVS
KKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAV
CKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGS
HAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVI
KEKYGKDATNVGDEGGFAPNILENKEALELLKTAIAKAG
YTDQVVIGMDVAASEFYRSGK

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.

products references :

Nucleotide sequences of cDNAs alpha and gamma enolase mRNAs from mouse brain.Kaghad M., Dumont X., Chalon P., Lelias J.M., Lamande N., Lucas M., Lazar M., Caput D.Nucleic Acids Res. 18:3638-3638(1990) Lubec G., Kang S.U., Klug S., Yang J.W., Zigmond M., Sunyer B., Chen W.-Q.Submitted (JAN-2009) to UniProtKB Cholesteryl ester loading of mouse peritoneal macrophages is associated with changes in the expression or modification of specific cellular proteins, including increase in an alpha-enolase isoform.Bottalico L.A., Kendrick N.C., Keller A., Li Y., Tabas I.Arterioscler. Thromb. 13:264-275(1993) Biochemical characterization of the mouse muscle-specific enolase developmental changes in electrophoretic variants and selective binding to other proteins.Merkulova T., Lucas M., Jabet C., Lamande N., Rouzeau J.-D., Gros F., Lazar M., Keller A.Biochem. J. 323:791-800(1997) Fibre-type distribution and subcellular localisation of alpha and beta enolase in mouse striated muscle.Keller A., Demeurie J., Merkulova T., Geraud G., Cywiner-Golenzer C., Lucas M., Chatelet F.-P.Biol. Cell 92:527-535(2000) Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.Giannakopoulos N.V., Luo J.K., Papov V., Zou W., Lenschow D.J., Jacobs B.S., Borden E.C., Li J., Virgin H.W., Zhang D.E.Biochem. Biophys. Res. Commun. 336:496-506(2005) Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain.Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.J. Proteome Res. 7:311-318(2008) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

ncbi gi num :

70794816

ncbi acc num :

NP_001020559.1

ncbi gb acc num :

NM_001025388.1

uniprot acc num :

P17182

ncbi mol weight :

51kD

ncbi pathways :

Biosynthesis Of Amino Acids Pathway (790952); Biosynthesis Of Amino Acids Pathway (795174); Carbon Metabolism Pathway (815838); Carbon Metabolism Pathway (817567); Gluconeogenesis Pathway (1324231); Gluconeogenesis, Oxaloacetate = Fructose-6P Pathway (421742); Gluconeogenesis, Oxaloacetate = Fructose-6P Pathway (468196); Glucose Metabolism Pathway (1324229); Glycolysis Pathway (1324230); Glycolysis (Embden-Meyerhof Pathway), Glucose = Pyruvate (421740)

ncbi summary :

This gene may represent an evolving pseudogene of the alpha-enolase (enolase 1, alpha non-neuron) gene, which has multiple pseudogenes. This gene has an intact open reading frame as well as strong transcriptional support. The length of encoded protein is conserved, compared to the original enolase 1 protein. The exact function of this gene is unknown. [provided by RefSeq, Jul 2008]

uniprot summary :

ENO1: an abundant cytoplasmic enzyme with 2-phospho-D-glycerate hydro-lyase activity. A target of excess protein nitration in Alzheimer disease (AD) brain. Tau-crystallin, a structural lens protein, is produced from an alternative translation start in the enolase gene. Protein type: Transcription, coactivator/corepressor; EC 4.2.1.11; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Lyase. Cellular Component: cytoplasm; extracellular space; extrinsic to plasma membrane; membrane; neuron projection; nucleus. Molecular Function: GTPase binding; heat shock protein binding; phosphopyruvate hydratase activity; protein heterodimerization activity; protein homodimerization activity; RNA binding. Biological Process: in utero embryonic development; positive regulation of binding

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage