AHCIRSNSVILLGRHNPYYPEDTGQVFQVSHSFPHPLYN
MSLLKNRYLGPGDDSSHDLMLLRLSEPAEITDAVQVLDL
PTWEPELGTTCYASGWGSIEPEEHLTPKKLQCVDLHIIS
NDVCAQVHSQKVTKFMLCAGSWMGGKSTCSGDSGGPLVC
DGVLQGITSWGSQPCALPRRPSLYTKVVRYRKWIQDTIM
ANP

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Macaca mulatta (Rhesus macaque) Osteocalcin (BGLAP) | MBS955547
- Recombinant Human Diacylglycerol kinase gamma | MBS955634
- Recombinant Mouse Alpha-enolase | MBS955655
- Recombinant Mouse Insulin-like growth factor-binding protein 1 | MBS955683
- Recombinant Pig Electron transfer flavoprotein-ubiquinone oxidoreductase, mitoch ...
