product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp)
catalog :
MBS955342
quantity :
1 mg (E Coli Derived
price :
1440 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS955342
products type :
Recombinant Protein
products full name :
Recombinant Mouse 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp)
products short name :
3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp)
products name syn :
Recombinant 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp); 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase EC= 5.3.3.5; Cholestenol Delta-isomerase Delta(8)-Delta(7) sterol isomerase; D8-D7 sterol isomerase Emopamil-binding protein
other names :
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; tattered; D8-D7 sterol isomerase; emopamil-binding protein; cholestenol Delta-isomerase; delta(8)-Delta(7) sterol isomerase; phenylalkylamine Ca2+ antagonist (emopamil) binding protein; Cholestenol Delta-isomerase; Delta(8)-Delta(7) sterol isomerase; D8-D7 sterol isomerase; Emopamil-binding protein
products gene name syn :
Ebp; Msi
other gene names :
Ebp; Ebp; Td; mSI; Pabp; AI255399; Msi; D8-D7 sterol isomerase
uniprot entry name :
EBP_MOUSE
host :
E Coli or Yeast
sequence positions :
2-230
sequence length :
230
sequence :
TTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISG
GLIVITWLLSSRASVVPLGAGRRLALCWFAVCTFIHLVI
EGWFSLYNGILLEDQAFLSQLWKEYSKGDSRYILSDSFV
VCMETVTACLWGPLSLWVVIAFLRQQPFRFVLQLVVSMG
QIYGDVLYFLTELHEGLQHGEIGHPVYFWFYFVFLNAVW
LVIPSILVLDAIKHLTSAQSVLDSKVMKIKSKHN
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Mus musculus (Mouse)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
6681255
ncbi acc num :
NP_031924.1
ncbi gb acc num :
NM_007898.2
uniprot acc num :
P70245
ncbi mol weight :
26,215 Da
ncbi pathways :
Cholesterol Biosynthesis Pathway 639925!!Cholesterol Biosynthesis, Squalene 2,3-epoxide = Cholesterol Pathway 421790!!Cholesterol Biosynthesis, Squalene 2,3-epoxide = Cholesterol Pathway 468282!!Metabolism Pathway 639859!!Metabolism Of Lipids And Lipoproteins Pathway 639889!!Steroid Biosynthesis Pathway 83137!!Steroid Biosynthesis Pathway 298!!Cholesterol Biosynthesis I Pathway 142914!!Cholesterol Biosynthesis II (via 24,25-dihydrolanosterol) Pathway 142913!!Cholesterol Biosynthesis III (via Desmosterol) Pathway 142915
uniprot summary :
Function: Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers. Catalytic activity: 5-alpha-cholest-7-en-3-beta-ol = 5-alpha-cholest-8-en-3-beta-ol. Pathway: Steroid biosynthesis; cholesterol biosynthesis. Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein. Involvement in disease: Note=Defects in Ebp are a cause of 'Tattered' (Td) which is an X-linked, semidominant mouse mutation associated with prenatal male lethality. Heterozygous females are small and at 4 to 5 days of age develop patches of hyperkeratotic skin where no hair grows, resulting in a striping of the coat in adults. Craniofacial anomalies and twisted toes have also been observed in some affected females. Miscellaneous: Binds to the phenylalkylamine calcium-ion antagonist emopamil, an anti-ischemic drug. Sequence similarities: Belongs to the EBP family.
size :
1 mg (E Coli Derived)
price :
1440 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!