protein

Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1

MBS955300

0.05 mg (Yeast)

185 USD

Recombinant Protein

Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1

Tyrosine-protein kinase transmembrane receptor ROR1

Neurotrophic tyrosine kinase, receptor-related 1

inactive tyrosine-protein kinase transmembrane receptor ROR1 isoform 2; Inactive tyrosine-protein kinase transmembrane receptor ROR1; inactive tyrosine-protein kinase transmembrane receptor ROR1; receptor tyrosine kinase-like orphan receptor 1; Neurotrophic tyrosine kinase, receptor-related 1

ROR1

ROR1; ROR1; NTRKR1; dJ537F10.1; NTRKR1

ROR1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

30-391

393

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNIT
TSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSF
RSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVL
FVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNR
TVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAI
PSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTE
YIFARSNPMILMRLKLPNCED

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neuroscience

Tyrosine-protein kinase receptor whose role is not yet clear.

A novel family of cell surface receptors with tyrosine kinase-like domain.Masiakowski P., Carroll R.D.J. Biol. Chem. 267:26181-26190(1992) Human neural tissues express a truncated Ror1 receptor tyrosine kinase, lacking both extracellular and transmembrane domains.Reddy U.R., Phatak S., Pleasure D.Oncogene 13:1555-1559(1996) The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006) Patterns of somatic mutation in human cancer genomes.Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G., Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.Nature 446:153-158(2007)

134152686

NP_001077061.1

NM_001083592.1

Q01973

44.6kD

Beta-catenin Independent WNT Signaling Pathway (1269610); Nuclear Receptors Pathway (198848); PCP/CE Pathway (1269611); Signal Transduction Pathway (1269379); Signaling By Wnt Pathway (1269594); WNT5A-dependent Internalization Of FZD2, FZD5 And ROR2 Pathway (1269614)

This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012]

ROR1: Tyrosine-protein kinase receptor whose role is not yet clear. Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm. Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Protein kinase, TK; Kinase, protein; Protein kinase, tyrosine (receptor); EC 2.7.10.1; Membrane protein, integral; TK group; Ror family. Chromosomal Location of Human Ortholog: 1p31.3. Cellular Component: cytoplasm; integral to plasma membrane; plasma membrane; receptor complex. Molecular Function: ATP binding; protein binding; transmembrane receptor protein tyrosine kinase activity; Wnt-protein binding. Biological Process: peptidyl-tyrosine phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; Wnt receptor signaling pathway

0.05 mg (Yeast)

185 USD

0.2 mg (Yeast)

420

0.5 mg (Yeast)

680

1 mg (Yeast)

1070