protein

Recombinant Mouse Importin subunit beta-1

MBS955236

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse Importin subunit beta-1

Importin subunit beta-1

Karyopherin subunit beta-1; Nuclear factor p97; Pore targeting complex 97 kDa subunit; PTAC97; SCG

importin subunit beta-1; Importin subunit beta-1; importin subunit beta-1; karyopherin (importin) beta 1; Karyopherin subunit beta-1; Nuclear factor p97; Pore targeting complex 97 kDa subunit; PTAC97; SCG

Kpnb1

Kpnb1; Kpnb1; IPOB; Impnb; AA409963; Impnb; PTAC97

IMB1_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

1-876

876

MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVE
LSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQ
RWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIA
CAEIPVSQWPELIPQLVANVTNPNSTEHMKESTLEAIGY
ICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAAT
NALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVR
VAALQNLVKIMSLYYQYMETY

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Functions in nuclear protein import, either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor. Acting autonomously, serves itself as NLS receptor. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with IPO7 mediates the nuclear import of H1 histone. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Imports SNAI1 and PRKCI into the nucleus.

Localization of the importin-beta gene to mouse chromosome 11D and rat chromosome 10q32.1.Matsuda Y., Hamatani K., Itoh M., Takahashi E., Araki R., Abe M.Genomics 36:213-215(1996) The nuclear pore-targeting complex binds to nuclear pores after association with a karyophile.Imamoto N., Shimamoto T., Kose S., Takao T., Tachibana T., Matsubae M., Sekimoto T., Shimonishi Y., Yoneda Y.FEBS Lett. 368:415-419(1995) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Multiple pathways contribute to nuclear import of core histones.Muehlhaeusser P., Mueller E.-C., Otto A., Kutay U.EMBO Rep. 2:690-696(2001) The C-terminal nuclear localization signal of the sex-determining region Y (SRY) high mobility group domain mediates nuclear import through importin beta 1.Forwood J.K., Harley V., Jans D.A.J. Biol. Chem. 276:46575-46582(2001) Comprehensive identification of phosphorylation sites in postsynaptic density preparations.Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.Mol. Cell. Proteomics 5:914-922(2006) Novel importin-alpha family member Kpna7 is required for normal fertility and fecundity in the mouse.Hu J., Wang F., Yuan Y., Zhu X., Wang Y., Zhang Y., Kou Z., Wang S., Gao S.J. Biol. Chem. 285:33113-33122(2010) The adoption of a twisted structure of importin-beta is essential for the protein-protein interaction required for nuclear transport.Lee S.J., Imamoto N., Sakai H., Nakagawa A., Kose S., Koike M., Yamamoto M., Kumasaka T., Yoneda Y., Tsukihara T.J. Mol. Biol. 302:251-264(2000) The structure of importin-beta bound to SREBP-2 nuclear import of a transcription factor.Lee S.J., Sekimoto T., Yamashita E., Nagoshi E., Nakagawa A., Imamoto N., Yoshimura M., Sakai H., Chong K.T., Tsukihara T., Yoneda Y.Science 302:1571-1575(2003)

88014720

NP_032405.3

NM_008379.3

P70168

101.2kD

Activation Of DNA Fragmentation Factor Pathway (1323554); Apoptosis Pathway (1323524); Apoptosis Induced DNA Fragmentation Pathway (1323553); Apoptotic Execution Phase Pathway (1323548); Metabolism Pathway (1324226); Metabolism Of Lipids And Lipoproteins Pathway (1324264); PluriNetWork Pathway (198307); Programmed Cell Death Pathway (1323523); RNA Transport Pathway (177887); RNA Transport Pathway (175229)

KPNB1: a nuclear import protein nuclear protein import that functions either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor. Acting autonomously, serves itself as NLS receptor. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re- exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with IPO7 mediates the nuclear import of H1 histone. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Imports PRKCI into the nucleus. Forms a complex with an importin alpha subunit. Forms a heterodimer with IPO7. Interacts with IPO7, SNUPN, RPL23A and XPO1. Two isoforms of the human protein have been reported. Belongs to the importin beta family. Protein type: Karyopherin; Nuclear import. Cellular Component: cytoplasm; membrane; nuclear envelope; nuclear membrane; nuclear pore; nucleoplasm; nucleus; protein complex. Molecular Function: enzyme binding; Hsp90 protein binding; kinesin binding; nuclear localization sequence binding; protein binding; protein complex binding; protein domain specific binding; protein transporter activity; Ran GTPase binding. Biological Process: astral microtubule organization and biogenesis; establishment of mitotic spindle localization; establishment of protein localization; intracellular protein transport; mitotic chromosome movement towards spindle pole; mitotic metaphase plate congression; NLS-bearing substrate import into nucleus; protein import into nucleus; protein import into nucleus, docking; protein import into nucleus, translocation; protein transport; Ran protein signal transduction; ribosomal protein import into nucleus; transport

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

950

0.5 mg (Yeast)

1055