product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-12 subunit alpha (IL12A)
catalog :
MBS955174
quantity :
1 mg (E-Coli)
price :
1370 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS955174
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-12 subunit alpha (IL12A)
products short name :
(Rhesus macaque) Interleukin-12 subunit alpha (IL12A)
products name syn :
Recombinant (Rhesus macaque) Interleukin-12 subunit alpha (IL12A); Interleukin-12 subunit alpha; IL-12A; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35 IL-12 subunit p35
other names :
interleukin-12 subunit alpha; Interleukin-12 subunit alpha; interleukin-12 subunit alpha; CLMF p35; IL-12 subunit p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35; IL-12 subunit p35
products gene name syn :
IL12A
other gene names :
IL12A; IL12A; IL-12A; IL-12A; CLMF p35
uniprot entry name :
IL12A_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-219
sequence length :
219
sequence :
RNLSVATPGPEMFPCLHHSQNLLKAASNTLQKARQILEF
YPCTSEEIDHEDITKDKTSTVEACLPLELIKNESCLNSR
ETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFK
TMNAKLLRDPKRQIFLDQNILGVIDELMQALNFNSETVP
QKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN
AS
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
113461959
ncbi acc num :
NP_001038199.1
ncbi gb acc num :
NM_001044734.1
uniprot acc num :
P48091
ncbi mol weight :
24,904 Da
ncbi pathways :
African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Amoebiasis Pathway (167336); Amoebiasis Pathway (167191); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460)
uniprot summary :
Function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC . By similarity. Subunit structure: Heterodimer with IL12B; disulfide-linked. The heterodimer is known as interleukin IL-12 . By similarity. Subcellular location: Secreted. Sequence similarities: Belongs to the IL-6 superfamily. Sequence caution: The sequence AAA86707.1 differs from that shown. Reason: Erroneous initiation.
size1 :
1 mg (E-Coli)
price1 :
1370 USD
size2 :
1 mg (Yeast)
price2 :
1825
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!