Recombinant Human Versican core protein (VCAN), partial | MyBioSource MBS955026 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Versican core protein (VCAN), partial

catalog :

MBS955026

quantity :

0.5 mg (E-Coli)

price :

960 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS955026

products type :

Recombinant Protein

products full name :

Recombinant Human Versican core protein (VCAN), partial

products short name :

Versican core protein (VCAN), partial

products name syn :

Versican core protein; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan 2; Glial hyaluronate-binding protein; GHAP; Large fibroblast proteoglycan; PG-M

other names :

versican core protein isoform 2; Versican core protein; versican core protein; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; versican; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan 2; Glial hyaluronate-binding protein; GHAP; Large fibroblast proteoglycan; PG-M

products gene name :

VCAN

products gene name syn :

VCAN; CSPG2

other gene names :

VCAN; VCAN; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; CSPG2; Chondroitin sulfate proteoglycan 2; GHAP

uniprot entry name :

CSPG2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1344-1554aa, partial of Versican isoform V0

sequence :

TDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTH PFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPF HEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAID
GHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEID
LYHSEENEEEEEECANA

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

other info1 :

Species: Homo sapiens (Human)

ncbi gi num :

187607300

ncbi acc num :

NP_001119808.1

ncbi gb acc num :

NM_001126336.2

uniprot acc num :

P13611

ncbi mol weight :

369,688 Da

ncbi pathways :

A Tetrasaccharide Linker Sequence Is Required For GAG Synthesis Pathway (645305); CS/DS Degradation Pathway (645311); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Chondroitin Sulfate Biosynthesis Pathway (645309); Chondroitin Sulfate/dermatan Sulfate Metabolism Pathway (645308); Dermatan Sulfate Biosynthesis Pathway (645310); Direct P53 Effectors Pathway (137939); Disease Pathway (530764); ECM Proteoglycans Pathway (833812)

ncbi summary :

This gene is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]

uniprot summary :

CSPG2: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. Defects in VCAN are the cause of Wagner syndrome type 1 (WGN1). WGN is a dominantly inherited vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia. Systemic manifestations are absent in WGN. Belongs to the aggrecan/versican proteoglycan family. 5 isoforms of the human protein are produced by alternative splicing. Protein type: Cell adhesion; Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 5q14.3. Cellular Component: extracellular matrix; proteinaceous extracellular matrix; extracellular space; lysosomal lumen; membrane; intracellular membrane-bound organelle; Golgi lumen; extracellular region. Molecular Function: protein binding; glycosaminoglycan binding; extracellular matrix structural constituent; hyaluronic acid binding; calcium ion binding; carbohydrate binding. Biological Process: extracellular matrix organization and biogenesis; chondroitin sulfate biosynthetic process; central nervous system development; glycosaminoglycan metabolic process; heart development; multicellular organismal development; pathogenesis; cell recognition; glial cell migration; dermatan sulfate biosynthetic process; chondroitin sulfate metabolic process; osteoblast differentiation; carbohydrate metabolic process; chondroitin sulfate catabolic process; cell adhesion; skeletal development. Disease: Wagner Vitreoretinopathy

size1 :

0.5 mg (E-Coli)

price1 :

960 USD

size2 :

0.05 mg (Baculovirus)

price2 :

960

size3 :

0.5 mg (Yeast)

price3 :

1185

size4 :

0.05 mg (Mammalian-Cell)

price4 :

1185

size5 :

1 mg (E-Coli)

price5 :

1415

more info or order :

MyBioSource product webpage