ATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMN
YRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAA
FGGNPKSVTLFGESAGAASVSLHL

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Rat Activin receptor type-2B (Acvr2b) | MBS954977
- Recombinant Human 26S protease regulatory subunit 4 (PSMC1) | MBS954983
- Recombinant Human Versican core protein (VCAN), partial | MBS955026
- Recombinant Rabbit Tumor necrosis factor-inducible gene 6 protein (TNFAIP6)
- Recombinant Mouse 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp)
