Recombinant Mouse CD81 antigen | MyBioSource MBS954966 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse CD81 antigen

catalog :

MBS954966

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS954966

products type :

Recombinant Protein

products full name :

Recombinant Mouse CD81 antigen

products short name :

CD81 antigen

products name syn :

26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; CD81

other names :

CD81 antigen; CD81 antigen; CD81 antigen; CD81 antigen; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; CD_antigen: CD81

products gene name :

Cd81

other gene names :

Cd81; Cd81; Tapa1; Tapa-1; Tspan28; Tapa1

uniprot entry name :

CD81_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

116-201

sequence length :

236

sequence :

KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETL
NCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQK
IDELFSGK

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.

products references :

Genomic organization and chromosomal localization of the TAPA-1 gene.Andria M.L., Hsieh C.L., Oren R., Francke U., Levy S.J. Immunol. 147:1030-1036(1991) Sequence conservation and variability of imprinting in the Beckwith-Wiedemann syndrome gene cluster in human and mouse.Paulsen M., El-Maarri O., Engemann S., Stroedicke M., Franck O., Davies K., Reinhardt R., Reik W., Walter J.Hum. Mol. Genet. 9:1829-1841(2000) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Duff K., Parsons J. Lubec G., Kang S.U.Submitted (APR-2007) to UniProtKB PGRL is a major CD81-associated protein on lymphocytes and distinguishes a new family of cell surface proteins.Clark K.L., Zeng Z., Langford A.L., Bowen S.M., Todd S.C.J. Immunol. 167:5115-5121(2001) Reduced fertility of female mice lacking CD81.Rubinstein E., Ziyyat A., Prenant M., Wrobel E., Wolf J.-P., Levy S., Le Naour F., Boucheix C.Dev. Biol. 290:351-358(2006) Expression of the mouse fragilis gene products in immune cells and association with receptor signaling complexes.Smith R.A., Young J., Weis J.J., Weis J.H.Genes Immun. 7:113-121(2006) Possible involvement of CD81 in acrosome reaction of sperm in mice.Tanigawa M., Miyamoto K., Kobayashi S., Sato M., Akutsu H., Okabe M., Mekada E., Sakakibara K., Miyado M., Umezawa A., Miyado K.Mol. Reprod. Dev. 75:150-155(2008)

ncbi gi num :

19526794

ncbi acc num :

NP_598416.1

ncbi gb acc num :

NM_133655.2

uniprot acc num :

P35762

ncbi mol weight :

36.8kD

ncbi pathways :

Adaptive Immune System Pathway (1323640); B Cell Receptor Signaling Pathway (198285); B Cell Receptor Signaling Pathway (83278); B Cell Receptor Signaling Pathway (492); Hepatitis C Pathway (173974); Hepatitis C Pathway (173907); Immune System Pathway (1323639); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (1323669); Malaria Pathway (152666); Malaria Pathway (152657)

uniprot summary :

CD81: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV. Defects in CD81 are the cause of immunodeficiency common variable type 6 (CVID6); also called antibody deficiency due to CD81 defect. CVID6 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. Belongs to the tetraspanin (TM4SF) family. Protein type: Membrane protein, integral; Membrane protein, multi-pass. Cellular Component: apical plasma membrane; focal adhesion; immunological synapse; integral to membrane; integral to plasma membrane; membrane; vesicle. Molecular Function: protein binding. Biological Process: activation of MAPK activity; cell surface receptor linked signal transduction; positive regulation of 1-phosphatidylinositol 4-kinase activity; positive regulation of B cell proliferation; positive regulation of cell growth; positive regulation of cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of transcription from RNA polymerase II promoter; protein localization; receptor internalization; regulation of cell proliferation; regulation of protein stability

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage