product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bovine Elongation of very long chain fatty acids protein 7 (ELOVL7)
catalog :
MBS954914
quantity :
1 mg (E Coli Derived
price :
1560 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS954914
products type :
Recombinant Protein
products full name :
Recombinant Bovine Elongation of very long chain fatty acids protein 7 (ELOVL7)
products short name :
Elongation of very long chain fatty acids protein 7 (ELOVL7)
products name syn :
Recombinant Elongation of very long chain fatty acids protein 7 (ELOVL7); Elongation of very long chain fatty acids protein 7 EC= 2.3.1.n8; 3-keto acyl-CoA synthase ELOVL7 ELOVL fatty acid elongase 7; ELOVL FA elongase 7
other names :
elongation of very long chain fatty acids protein 7; Elongation of very long chain fatty acids protein 7; elongation of very long chain fatty acids protein 7; ELOVL FA elongase 7; 3-keto acyl-CoA synthase ELOVL7; very-long-chain 3-oxoacyl-CoA synthase 7; ELOVL family member 7, elongation of long chain fatty acids; ELOVL fatty acid elongase 7<; 3-keto acyl-CoA synthase ELOVL7; ELOVL fatty acid elongase 7; ELOVL FA elongase 7; Very-long-chain 3-oxoacyl-CoA synthase 7
products gene name syn :
ELOVL7
other gene names :
ELOVL7; ELOVL7; ELOVL FA elongase 7
uniprot entry name :
ELOV7_BOVIN
host :
E Coli or Yeast
sequence positions :
1-281
sequence length :
281
sequence :
MAFSDLTSRTVRLYDNWIKDADPRVEDWLLMSSPLPQTI
ILGFYVYFVTSLGPKLMENRKPFELKKVMITYNFSIVLF
SVYMFYEFIMSGWGTGYSFRCDIVDYSQSPTALRMVRTC
WLYYFSKFIELLDTIFFILRKKNSQVTFLHVFHHTIMPW
TWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCALGP
DYQKYLWWKKYLTSLQLIQFVLITIHISQFFFMEDCKYQ
FPVFQYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTVKH
GICKNKDH
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Bos taurus (Bovine)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
118151176
ncbi acc num :
NP_001071510.1
ncbi gb acc num :
NM_001078042.1
uniprot acc num :
A0JNC4
ncbi mol weight :
33,639 Da
ncbi pathways :
Fatty Acyl-CoA Biosynthesis Pathway 637178!!Fatty Acid Biosynthesis, Elongation, Endoplasmic Reticulum Pathway 391109!!Fatty Acid Biosynthesis, Elongation, Endoplasmic Reticulum Pathway 468402!!Fatty Acid Elongation Pathway 84180!!Fatty Acid Elongation Pathway 295!!Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway 637176!!Metabolism Pathway 637141!!Metabolism Of Lipids And Lipoproteins Pathway 637167!!Synthesis Of Very Long-chain Fatty Acyl-CoAs Pathway 637179!!Triglyceride Biosynthesis Pathway 637177
uniprot summary :
Function: Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs . By similarity. Catalytic activity: A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO2. Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein . By similarity. Domain: The di-lysine motif may confer endoplasmic reticulum localization . By similarity. Sequence similarities: Belongs to the ELO family.
size :
1 mg (E Coli Derived)
price :
1560 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!