protein

Recombinant Human Collagen alpha-1(IV) chain

MBS954904

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Collagen alpha-1(IV) chain

Collagen alpha-1(IV) chain

collagen alpha-1(IV) chain isoform 2; Collagen alpha-1(IV) chain; collagen alpha-1(IV) chain; collagen type IV alpha 1

COL4A1

COL4A1; COL4A1; BSVD; RATOR

CO4A1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1445-1669

519

GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAH
GQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYW
LSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVH
SQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALAS
PGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERS
EMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cancer

Type IV collagen is the major structural component of glomerular basent membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin.

Structural organization of the gene for the alpha 1 chain of human type IV collagen.Soininen R., Huotari M., Ganguly A., Prockop D.J., Tryggvason K.J. Biol. Chem. 264:13565-13571(1989) The DNA sequence and analysis of human chromosome 13.Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.Nature 428:522-528(2004) Completion of the amino acid sequence of the alpha 1 chain of human basement membrane collagen (type IV) reveals 21 non-triplet interruptions located within the collagenous domain.Brazel D., Oberbaeumer I., Dieringer H., Babel W., Glanville R.W., Deutzmann R., Kuehn K.Eur. J. Biochem. 168:529-536(1987) The structural genes for alpha 1 and alpha 2 chains of human type IV collagen are divergently encoded on opposite DNA strands and have an overlapping promoter region.Soininen R., Huotari M., Hostikka S.L., Prockop D.J., Tryggvason K.J. Biol. Chem. 263:17217-17220(1988) Amino acid sequence of the N-terminal aggregation and cross-linking region (7S domain) of the alpha 1 (IV) chain of human basement membrane collagen.Glanville R.W., Qian R.Q., Siebold B., Risteli J., Kuehn K.Eur. J. Biochem. 152:213-219(1985) Complete primary structure of the alpha 1-chain of human basement membrane (type IV) collagen.Soininen R., Haka-Risku T., Prockop D.J., Tryggvason K.FEBS Lett. 225:188-194(1987) Structure of human-basement-membrane (type IV) collagen. Complete amino-acid sequence of a 914-residue-long pepsin fragment from the alpha 1(IV) chain.Babel W., Glanville R.W.Eur. J. Biochem. 143:545-556(1984) cDNA clones coding for the pro-alpha1(IV) chain of human type IV procollagen reveal an unusual homology of amino acid sequences in two halves of the carboxyl-terminal domain.Pihlajaniemi T., Tryggvason K., Myers J.C., Kurkinen M., Lebo R., Cheung M.-C., Prockop D.J., Boyd C.D.J. Biol. Chem. 260:7681-7687(1985) Restricted homology between human alpha 1 type IV and other procollagen chains.Brinker J.M., Gudas L.J., Loidl H.R., Wang S.-Y., Rosenbloom J., Kefalides N.A., Myers J.C.Proc. Natl. Acad. Sci. U.S.A. 82:3649-3653(1985) The arrangement of intra- and intermolecular disulfide bonds in the carboxyterminal, non-collagenous aggregation and cross-linking domain of basement-membrane type IV collagen.Siebold B., Deutzmann R., Kuehn K.Eur. J. Biochem. 176:617-624(1988) Anti-angiogenic cues from vascular basement membrane collagen.Colorado P.C., Torre A., Kamphaus G., Maeshima Y., Hopfer H., Takahashi K., Volk R., Zamborsky E.D., Herman S., Sarkar P.K., Ericksen M.B., Dhanabal M., Simons M., Post M., Kufe D.W., Weichselbaum R.R., Sukhatme V.P., Kalluri R.Cancer Res. 60:2520-2526(2000) Arresten, a collagen-derived inhibitor of angiogenesis.Fu J., Bai X., Wang W., Ruan C.Peng X., Yin B., Yuan J., Qiang B.Molecular cloning and sequencing of human arresten gene.Zheng Q.C., Song Z.F., Zheng Y.W., Li Y.Q., Shu X.Zhonghua Shi Yan Wai Ke Za Zhi 19:46-47(2002) Cloning and expression of arresten in Escherichia coli and Pachia pastoris.He A.B.Construction of recombinant plasmid and prokaryotic expression in E. coli and biological activity analysis of human placenta arresten gene.Zheng J.P., Tang H.Y., Chen X.J., Yu B.F., Xie J., Wu T.C.Hepatobiliary Pancreat. Dis. Int. 5:74-79(2006) Human alpha1 type IV collagen NC1 domain exhibits distinct antiangiogenic activity mediated by alpha1beta1 integrin.Sudhakar A., Nyberg P., Keshamouni V.G., Mannam A.P., Li J., Sugimoto H., Cosgrove D., Kalluri R.J. Clin. Invest. 115:2801-2810(2005) Characterization of the anti-angiogenic properties of arresten, an alpha1beta1 integrin-dependent collagen-derived tumor suppressor.Nyberg P., Xie L., Sugimoto H., Colorado P., Sund M., Holthaus K., Sudhakar A., Salo T., Kalluri R.Exp. Cell Res. 314:3292-3305(2008) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) The 1.9-A crystal structure of the noncollagenous (NC1) domain of human placenta collagen IV shows stabilization via a novel type of covalent Met-Lys cross-link.Than M.E., Henrich S., Huber R., Ries A., Mann K., Kuhn K., Timpl R., Bourenkov G.P., Bartunik H.D., Bode W.Proc. Natl. Acad. Sci. U.S.A. 99:6607-6612(2002) Mutations in Col4a1 cause perinatal cerebral hemorrhage and porencephaly.Gould D.B., Phalan F.C., Breedveld G.J., van Mil S.E., Smith R.S., Schimenti J.C., Aguglia U., van der Knaap M.S., Heutink P., John S.W.M.Science 308:1167-1171(2005) Novel mutations in three families confirm a major role of COL4A1 in hereditary porencephaly.Breedveld G., de Coo I.F., Lequin M.H., Arts W.F.M., Heutink P., Gould D.B., John S.W.M., Oostra B., Mancini G.M.S.J. Med. Genet. 43:490-495(2006) Role of COL4A1 in small-vessel disease and hemorrhagic stroke.Gould D.B., Phalan F.C., van Mil S.E., Sundberg J.P., Vahedi K., Massin P., Bousser M.G., Heutink P., Miner J.H., Tournier-Lasserve E., John S.W.M.N. Engl. J. Med. 354:1489-1496(2006) COL4A1 mutation in Axenfeld-Rieger anomaly with leukoencephalopathy and stroke.Sibon I., Coupry I., Menegon P., Bouchet J.P., Gorry P., Burgelin I., Calvas P., Orignac I., Dousset V., Lacombe D., Orgogozo J.M., Arveiler B., Goizet C.Ann. Neurol. 62:177-184(2007) COL4A1 mutations and hereditary angiopathy, nephropathy, aneurysms, and muscle cramps.Plaisier E., Gribouval O., Alamowitch S., Mougenot B., Prost C., Verpont M.C., Marro B., Desmettre T., Cohen S.Y., Roullet E., Dracon M., Fardeau M., Van Agtmael T., Kerjaschki D., Antignac C., Ronco P.N. Engl. J. Med. 357:2687-2695(2007) A sulfilimine bond identified in collagen IV.Vanacore R., Ham A.-J.L., Voehler M., Sanders C.R., Conrads T.P., Veenstra T.D., Sharpless K.B., Dawson P.E., Hudson B.G.Science 325:1230-1234(2009) COL4A1 mutation in a patient with sporadic, recurrent intracerebral hemorrhage.Vahedi K., Kubis N., Boukobza M., Arnoult M., Massin P., Tournier-Lasserve E., Bousser M.G.Stroke 38:1461-1464(2007) COL4A1 mutation in two preterm siblings with antenatal onset of parenchymal hemorrhage.de Vries L.S., Koopman C., Groenendaal F., Van Schooneveld M., Verheijen F.W., Verbeek E., Witkamp T.D., van der Worp H.B., Mancini G.Ann. Neurol. 65:12-18(2009) Novel COL4A1 mutations associated with HANAC syndrome a role for the triple helical CB3 domain.Plaisier E., Chen Z., Gekeler F., Benhassine S., Dahan K., Marro B., Alamowitch S., Paques M., Ronco P.Am. J. Med. Genet. A 152:2550-2555(2010) Ophthalmological features associated with COL4A1 mutations.Coupry I., Sibon I., Mortemousque B., Rouanet F., Mine M., Goizet C.Arch. Ophthalmol. 128:483-489(2010) A dominantly inherited mutation in collagen IV A1 (COL4A1) causing childhood onset stroke without porencephaly.Shah S., Kumar Y., McLean B., Churchill A., Stoodley N., Rankin J., Rizzu P., van der Knaap M., Jardine P.Eur. J. Paediatr. Neurol. 14:182-187(2010) Sequence variants in COL4A1 and COL4A2 genes in Ecuadorian families with keratoconus.Karolak J.A., Kulinska K., Nowak D.M., Pitarque J.A., Molinari A., Rydzanicz M., Bejjani B.A., Gajecka M.Mol. Vis. 17:827-843(2011) +Additional computationally mapped references. p>Provides general information on the entry.

734520332

NP_001290039.1

NM_001303110.1

P02462

40.9kD

AGE-RAGE Signaling Pathway In Diabetic Complications (1319988); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); Amoebiasis Pathway (167324); Amoebiasis Pathway (167191); Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1270247); Axon Guidance Pathway (1270303); Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1269897); Collagen Biosynthesis And Modifying Enzymes Pathway (1270246); Collagen Formation Pathway (1270245); Developmental Biology Pathway (1270302)

This gene encodes a type IV collagen alpha protein. Type IV collagen proteins are integral components of basement membranes. This gene shares a bidirectional promoter with a paralogous gene on the opposite strand. The protein consists of an amino-terminal 7S domain, a triple-helix forming collagenous domain, and a carboxy-terminal non-collagenous domain. It functions as part of a heterotrimer and interacts with other extracellular matrix components such as perlecans, proteoglycans, and laminins. In addition, proteolytic cleavage of the non-collagenous carboxy-terminal domain results in a biologically active fragment known as arresten, which has anti-angiogenic and tumor suppressor properties. Mutations in this gene cause porencephaly, cerebrovascular disease, and renal and muscular defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

950

0.5 mg (Yeast)

950