Recombinant Mouse Protein Wnt-3a | MyBioSource MBS954891 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Protein Wnt-3a

catalog :

MBS954891

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS954891

products type :

Recombinant Protein

products full name :

Recombinant Mouse Protein Wnt-3a

products short name :

Wnt-3a

other names :

protein Wnt-3a; Protein Wnt-3a; protein Wnt-3a; wingless-type MMTV integration site family, member 3A

products gene name :

Wnt3a

other gene names :

Wnt3a; Wnt3a; vt; Wnt-3a; Wnt-3a

uniprot entry name :

WNT3A_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

19-352

sequence length :

352

sequence :

SYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCR
NYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLA
IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAI
CGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARE
NRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCE
VKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGW
VETLRPRYTYFKVPTERDLVY

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

Ligand for mbers of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

products references :

Expression of two members of the Wnt family during mouse development -- restricted temporal and spatial patterns in the developing neural tube.Roelink H., Nusse R.Genes Dev. 5:381-388(1991) The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.Tanaka K., Okabayashi H., Asashima M., Perrimon N., Kadowaki T.Eur. J. Biochem. 267:4300-4311(2000) Wnt proteins are lipid-modified and can act as stem cell growth factors.Willert K., Brown J.D., Danenberg E., Duncan A.W., Weissman I.L., Reya T., Yates J.R. III, Nusse R.Nature 423:448-452(2003) Tiki1 is required for head formation via Wnt cleavage-oxidation and inactivation.Zhang X., Abreu J.G., Yokota C., Macdonald B.T., Singh S., Coburn K.L., Cheong S.M., Zhang M.M., Ye Q.Z., Hang H.C., Steen H., He X.Cell 149:1565-1577(2012) Monounsaturated fatty acid modification of Wnt protein its role in Wnt secretion.Takada R., Satomi Y., Kurata T., Ueno N., Norioka S., Kondoh H., Takao T., Takada S.Dev. Cell 11:791-801(2006) Identification of key residues and regions important for porcupine-mediated Wnt acylation.Rios-Esteves J., Haugen B., Resh M.D.J. Biol. Chem. 289:17009-17019(2014)

ncbi gi num :

7106447

ncbi acc num :

NP_033548.1

ncbi gb acc num :

NM_009522.2

uniprot acc num :

P27467

ncbi mol weight :

39.3KD

uniprot summary :

WNT3A: Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Interacts with PORCN. Interacts with APCDD1 and WLS. Component of the Wnt-Fzd-LRP5-LRP6 signaling complex that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts directly in the complex with LRP6. Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate. Belongs to the Wnt family. Protein type: Secreted, signal peptide; Secreted. Cellular Component: cell surface; extracellular region; extracellular space; proteinaceous extracellular matrix. Molecular Function: frizzled binding; frizzled-2 binding; protein binding; protein domain specific binding; receptor agonist activity; receptor binding; transcription coactivator activity. Biological Process: anterior/posterior pattern formation; axon guidance; axonogenesis; BMP signaling pathway; cell proliferation in forebrain; cell proliferation in midbrain; cell-cell signaling; determination of left/right symmetry; dorsoventral neural tube patterning; extracellular matrix organization and biogenesis; heart looping; hemopoiesis; hippocampus development; in utero embryonic development; inner ear morphogenesis; mammary gland development; mesoderm development; midbrain development; multicellular organismal development; negative regulation of axon extension involved in axon guidance; negative regulation of fat cell differentiation; negative regulation of neurogenesis; neurogenesis; organ morphogenesis; osteoblast differentiation; palate development; paraxial mesodermal cell fate commitment; platelet activation; positive regulation of B cell proliferation; positive regulation of caspase activity; positive regulation of cell proliferation; positive regulation of collateral sprouting in the absence of injury; positive regulation of cytokine production; positive regulation of mesodermal cell fate specification; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein amino acid phosphorylation; positive regulation of protein binding; positive regulation of protein kinase activity; positive regulation of receptor internalization; positive regulation of skeletal muscle development; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of axonogenesis; regulation of cell differentiation; signal transduction; signalosome assembly; somatic stem cell division; somitogenesis; spinal cord association neuron differentiation; Wnt receptor signaling pathway; Wnt receptor signaling pathway in forebrain neuroblast division; Wnt receptor signaling pathway through beta-catenin

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

1095

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage