protein

Recombinant Human Glial fibrillary acidic protein

MBS954882

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Human Glial fibrillary acidic protein

Glial fibrillary acidic protein

glial fibrillary acidic protein isoform 2; Glial fibrillary acidic protein; glial fibrillary acidic protein; glial fibrillary acidic protein

GFAP

GFAP; GFAP; ALXDRD; GFAP

GFAP_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

292-432

431

LTCDLESLRGTNESLERQMREQEERHVREAASYQEALAR
LEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKL
LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNI
VVKTVEMRDGEVIKESKQEHKDVM

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neuroscience

GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.

Molecular cloning and primary structure of human glial fibrillary acidic protein.Reeves S.A., Helman L.J., Allison A., Israel M.A.Proc. Natl. Acad. Sci. U.S.A. 86:5178-5182(1989) Characterization of human cDNA and genomic clones for glial fibrillary acidic protein.Brenner M., Lampel K., Nakatani Y., Mill J., Banner C., Mearow K., Dohadwala M., Lipsky R., Freese E.Brain Res. Mol. Brain Res. 7:277-286(1990) Human glial fibrillary acidic protein complementary DNA cloning, chromosome localization, and messenger RNA expression in human glioma cell lines of various phenotypes.Bongcam-Rudloff E., Nister M., Betsholtz C., Wang J.-L., Stenman G., Huebner K., Croce C.M., Westermark B.Cancer Res. 51:1553-1560(1991) Human glial fibrillary acidic protein (GFAP) molecular cloning of the complete cDNA sequence and chromosomal localization (chromosome 17) of the GFAP gene.Kumanishi T., Usui H., Ichikawa T., Nishiyama A., Katagiri T., Abe S., Yoshida Y., Washiyama K., Kuwano R., Sakimura K.Acta Neuropathol. 83:569-578(1992) Determination of the gene structure of human GFAP and absence of coding region mutations associated with frontotemporal dementia with parkinsonism linked to chromosome 17.Isaacs A., Baker M., Wavrant-De Vrieze F., Hutton M.Genomics 51:152-154(1998) Han C., Zhang B., Zhou Y., Peng X., Yuan J., Qiang B.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006)

196115290

NP_001124491.1

NM_001131019.2

P14136

20.5kD

Jak-STAT Signaling Pathway (83077); Jak-STAT Signaling Pathway (488); Neural Crest Differentiation Pathway (672460); Nuclear Signaling By ERBB4 Pathway (1269499); Signal Transduction Pathway (1269379); Signaling By ERBB4 Pathway (1269496); Spinal Cord Injury Pathway (739007)

This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]

GFAP: a class-III intermediate filament protein. A cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. An additional transcript variant isoform has been described, but its full length sequence has not been determined. Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 17q21. Cellular Component: cytoplasm; cytosol; intermediate filament; intermediate filament cytoskeleton; lysosome; membrane; myelin sheath. Molecular Function: integrin binding; kinase binding; protein binding; structural constituent of cytoskeleton. Biological Process: astrocyte development; Bergmann glial cell differentiation; extracellular matrix organization and biogenesis; intermediate filament organization; neurite regeneration; regulation of neurotransmitter uptake; regulation of protein complex assembly; response to wounding. Disease: Alexander Disease

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070