product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Syndecan-1
catalog :
MBS954839
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS954839
products type :
Recombinant Protein
products full name :
Recombinant Rat Syndecan-1
products short name :
Syndecan-1
products name syn :
CD138
other names :
syndecan-1; Syndecan-1; syndecan-1; syndecan 1; CD_antigen: CD138
products gene name :
Sdc1
other gene names :
Sdc1; Sdc1; HSPG; Synd1; SYNDECA; Syndecan; Synd1; SYND1
uniprot entry name :
SDC1_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-257
sequence length :
313
sequence :
QIVTANVPPEDQDGSGDDSDNFSGSGTGALPDMTLSRQT
PSTWKDVWLLTATPTAPEPTSRDTEATLTSILPAGEKPE
EGEPVAHVEAEPDFTARDKEKEATTRPRETTQLPVTQQA
STAARATTAQASVTSHPHGDVQPGLHETLAPTAPGQPDH
QPPSVEDGGTSVIKEVVEDETTNQLPAGEGSGEQDFTFE
TSGENTAVAGVEPDLRNQSPVDEGATGASQGLLDRKEVL
G
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
products references :
Molecular cloning and expression of two distinct cDNA-encoding heparan sulfate proteoglycan core proteins from a rat endothelial cell line.Kojima T., Shworak N.W., Rosenberg R.D.J. Biol. Chem. 267:4870-4877(1992) Isolation and characterization of ryudocan and syndecan heparan sulfate proteoglycans, core proteins, and cDNAs from a rat endothelial cell line.Shworak N.W., Kojima T., Rosenberg R.D.Haemostasis 23:161-176(1993) Regulated expression of syndecan in vascular smooth muscle cells and cloning of rat syndecan core protein cDNA.Cizmeci-Smith G., Asundi V., Stahl R.C., Teichman L.J., Chernousov M., Cowan K., Carey D.J.J. Biol. Chem. 267:15729-15736(1992)
ncbi gi num :
6981518
ncbi acc num :
NP_037158.1
ncbi gb acc num :
NM_013026.2
uniprot acc num :
P26260
ncbi mol weight :
51.9kD
ncbi pathways :
A Tetrasaccharide Linker Sequence Is Required For GAG Synthesis Pathway (1333296); Cell Adhesion Molecules (CAMs) Pathway (83461); Cell Adhesion Molecules (CAMs) Pathway (480); Chondroitin Sulfate/dermatan Sulfate Metabolism Pathway (1333299); Chylomicron-mediated Lipid Transport Pathway (1333315); ECM-receptor Interaction Pathway (83460); ECM-receptor Interaction Pathway (479); Extracellular Matrix Organization Pathway (1332737); Glycosaminoglycan Metabolism Pathway (1333287); HS-GAG Biosynthesis Pathway (1333297)
ncbi summary :
mouse homolog promotes cell-cell adhesion [RGD, Feb 2006]
uniprot summary :
syndecan-1: Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix. Belongs to the syndecan proteoglycan family. Protein type: Motility/polarity/chemotaxis; Extracellular matrix; Membrane protein, integral. Cellular Component: cell surface; cytoplasm; external side of plasma membrane; focal adhesion; integral to membrane; protein complex. Molecular Function: extracellular matrix binding; glycoprotein binding; protein binding; protein C-terminus binding. Biological Process: cell adhesion; cell migration; cell-cell signaling; inflammatory response; myoblast development; odontogenesis; response to calcium ion; response to cAMP; response to glucocorticoid stimulus; response to hydrogen peroxide; response to organic substance; response to toxin; Sertoli cell development; striated muscle cell development; ureteric bud development; Wnt receptor signaling pathway through beta-catenin; wound healing
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!