protein

Recombinant Mouse Annexin A1

MBS954685

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Mouse Annexin A1

Annexin A1

Annexin I; Annexin-1; Calpactin II; Calpactin-2; Chromobindin-9; Lipocortin I; Phospholipase A2 inhibitory protein; p35

annexin A1; Annexin A1; annexin A1; annexin A1; Annexin I; Annexin-1; Calpactin II; Calpactin-2; Chromobindin-9; Lipocortin I

Anxa1

Anx1; Lpc-1; Lpc1

Anxa1; Anxa1; Lpc1; Anx-1; Lpc-1; Anx-A1; C430014K04Rik; Anx1; Lpc-1; Lpc1

ANXA1_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

2-346

346

AMVSEFLKQARFLENQEQEYVQAVKSYKGGPGSAVSPYP
SFNVSSDVAALHKAIMVKGVDEATIIDILTKRTNAQRQQ
IKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQF
DADELRGAMKGLGTDEDTLIEILTTRSNEQIREINRVYR
EELKRDLAKDITSDTSGDFRKALLALAKGDRCQDLSVNQ
DLADTDARALYEAGERRKGTDVNVFTTILTSRSFPHLRR
VFQNYGKYSQHDMNKALDLEL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. This protein regulates phospholipase A2 activity. It ses to bind from two to four calcium ions with high affinity.

Mouse lipocortin I cDNA.Sakata T., Iwagami S., Tsuruta Y., Suzuki R., Hojo K., Sato K., Teraoka H.Nucleic Acids Res. 16:11818-11818(1988) Mouse lipocortin I gene structure and chromosomal assignment gene duplication and the origins of a gene family.Horlick K.R., Cheng I.C., Wong W.T., Wakeland E.K., Nick H.S.Genomics 10:365-374(1991) cDNA-cloning, sequencing and expression in glucocorticoid-stimulated quiescent Swiss 3T3 fibroblasts of mouse lipocortin I.Philipps C., Rose-John S., Rincke G., Fuerstenberger G., Marks F.Biochem. Biophys. Res. Commun. 159:155-162(1989) Dysferlin interacts with annexins A1 and A2 and mediates sarcolemmal wound-healing.Lennon N.J., Kho A., Bacskai B.J., Perlmutter S.L., Hyman B.T., Brown R.H. Jr.J. Biol. Chem. 278:50466-50473(2003) Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry.Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.Mol. Cell. Proteomics 8:904-912(2009) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

124517663

NP_034860.2

NM_010730.2

P10107

42.7kD

Class A/1 (Rhodopsin-like Receptors) Pathway (1324706); Formyl Peptide Receptors Bind Formyl Peptides And Many Other Ligands Pathway (1324712); G Alpha (i) Signalling Events Pathway (1324737); G Alpha (q) Signalling Events Pathway (1324739); GPCR Downstream Signaling Pathway (1324735); GPCR Ligand Binding Pathway (1324705); Gastrin-CREB Signalling Pathway Via PKC And MAPK (1324753); Peptide Ligand-binding Receptors Pathway (1324707); Prostaglandin Synthesis And Regulation Pathway (198286); Signal Transduction Pathway (1324550)

ANXA1: a calcium/phospholipid-binding protein with which promotes membrane fusion and is involved in endocytosis. Has anti-inflammatory properties and inhibits phospholipase A2 activity. Accumulates on internalized vesicles after EGF-stimulated endocytosis, suggesting that it may be required for a late stage in inward vesiculation. Phosphorylated by PKC, EGFR and Chak1. Phosphorylation results in loss of the inhibitory activity. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion. Protein type: Calcium-binding; Lipid-binding. Cellular Component: apical plasma membrane; cell projection; cell surface; cilium; cornified envelope; cytoplasm; cytoplasmic vesicle; endosome; extracellular region; extracellular space; extrinsic to external side of plasma membrane; extrinsic to membrane; focal adhesion; lateral plasma membrane; mast cell granule; membrane; mitochondrial membrane; nucleoplasm; nucleus; plasma membrane; protein complex; sarcolemma; vesicle. Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; calcium-dependent protein binding; double-stranded DNA-dependent ATPase activity; helicase activity; metal ion binding; phospholipase A2 inhibitor activity; phospholipase inhibitor activity; phospholipid binding; protein binding; protein binding, bridging; protein homodimerization activity; single-stranded DNA binding; single-stranded RNA binding; structural molecule activity. Biological Process: actin cytoskeleton reorganization; adaptive immune response; alpha-beta T cell differentiation; arachidonic acid secretion; cell surface receptor linked signal transduction; DNA duplex unwinding; DNA strand renaturation; G-protein signaling, coupled to cyclic nucleotide second messenger; immune system process; inflammatory response; innate immune response; insulin secretion; keratinocyte differentiation; monocyte chemotaxis; myoblast migration involved in skeletal muscle regeneration; negative regulation of exocytosis; negative regulation of protein secretion; negative regulation of T-helper 2 cell differentiation; neutrophil homeostasis; peptide cross-linking; phagocytosis; positive regulation of apoptosis; positive regulation of interleukin-2 production; positive regulation of neutrophil apoptosis; positive regulation of prostaglandin biosynthetic process; positive regulation of T cell proliferation; positive regulation of T-helper 1 cell differentiation; positive regulation of vesicle fusion; regulation of cell proliferation; regulation of cell shape; regulation of hormone secretion; regulation of inflammatory response; regulation of interleukin-1 production; regulation of leukocyte migration; signal transduction

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070