GIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLK
GVKGNPGNIRDQPRPAFSAIRQNPPTYGNVVVFDKVLTN
QENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSS
SRGQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWI
EKDPAKGRIYQGTEADSIFSGFLIFPSA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Mouse T-cell surface glycoprotein CD8 beta chain (Cd8b) | MBS954743
- Recombinant Macaca mulatta (Rhesus macaque) Muscarinic acetylcholine receptor M1 ...
- Recombinant Macaca mulatta (Rhesus macaque) 5-hydroxytryptamine receptor 2A (HTR ...
- Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1) | MBS954865
- Recombinant Rabbit Tumor necrosis factor-inducible gene 6 protein (TNFAIP6)
