Recombinant Human DNA replication licensing factor MCM2 | MyBioSource MBS954533 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human DNA replication licensing factor MCM2

catalog :

MBS954533

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS954533

products type :

Recombinant Protein

products full name :

Recombinant Human DNA replication licensing factor MCM2

products short name :

DNA replication licensing factor MCM2

products name syn :

Minichromosome maintenance protein 2 homolog; Nuclear protein BM28

other names :

DNA replication licensing factor MCM2; DNA replication licensing factor MCM2; DNA replication licensing factor MCM2; minichromosome maintenance complex component 2; Minichromosome maintenance protein 2 homolog; Nuclear protein BM28

products gene name :

MCM2

other gene names :

MCM2; MCM2; BM28; CCNL1; CDCL1; cdc19; D3S3194; MITOTIN; BM28; CCNL1; CDCL1; KIAA0030

uniprot entry name :

MCM2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-904

sequence length :

904

sequence :

AESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTS
SPGRDLPPFEDESEGLLGTEGPLEEEEDGEELIGDGMER
DYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMR
QRDREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERA
TEDGEEDEEMIESIENLEDLKGHSVREWVSMAGPRLEIH
HRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYE
DLAAREHVLAYFLPEAPAELL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cell Cycle

products description :

Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for the entry in S phase and for cell division.

products references :

A human nuclear protein with sequence homology to a family of early S phase proteins is required for entry into S phase and for cell division.Todorov I.T., Pepperkok R., Philipova R.N., Kearsey S.E., Ansorge W., Werner D.J. Cell Sci. 107:253-265(1994)

ncbi gi num :

33356547

ncbi acc num :

NP_004517.2

ncbi gb acc num :

NM_004526.3

uniprot acc num :

P49736

ncbi mol weight :

105.8kD

ncbi pathways :

Activation Of ATR In Response To Replication Stress Pathway (1269757); Activation Of The Pre-replicative Complex Pathway (1269773); Assembly Of The Pre-replicative Complex Pathway (1269833); Cell Cycle Pathway (1269741); Cell Cycle Checkpoints Pathway (1269742); Cell Cycle, Mitotic Pathway (1269763); Cell Cycle Pathway (198811); Cell Cycle Pathway (83054); Cell Cycle Pathway (463); DNA Replication Pathway (198771)

ncbi summary :

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq, Oct 2012]

uniprot summary :

MCM2: a mini-chromosome maintenance protein, essential for the initiation of eukaryotic genome replication. Allows DNA to undergo a single round of replication per cell cycle. Required for the entry in S phase and for cell division. Protein type: DNA-binding; EC 3.6.4.12. Chromosomal Location of Human Ortholog: 3q21. Cellular Component: chromatin; cytoplasm; MCM complex; microtubule cytoskeleton; nuclear chromosome, telomeric region; nuclear origin of replication recognition complex; nucleoplasm; nucleus. Molecular Function: ATP binding; DNA binding; DNA helicase activity; DNA replication origin binding; histone binding; metal ion binding; protein binding. Biological Process: cell cycle; DNA replication; DNA replication initiation; DNA strand elongation during DNA replication; DNA unwinding during replication; G1/S transition of mitotic cell cycle; mitotic cell cycle; nucleosome assembly

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage