Recombinant Human NADPH:adrenodoxin oxidoreductase, mitochondrial | MyBioSource MBS954443 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human NADPH:adrenodoxin oxidoreductase, mitochondrial

catalog :

MBS954443

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS954443

products type :

Recombinant Protein

products full name :

Recombinant Human NADPH:adrenodoxin oxidoreductase, mitochondrial

products short name :

NADPH:adrenodoxin oxidoreductase

products name syn :

Ferredoxin-NADP(+) reductase; Ferredoxin reductase

other names :

NADPH:adrenodoxin oxidoreductase, mitochondrial isoform 3; NADPH:adrenodoxin oxidoreductase, mitochondrial; Ferredoxin--NADP(+) reductase; Ferredoxin reductase

products gene name :

FDXR

other gene names :

FDXR; ADXR; AR; Adrenodoxin reductase; Ferredoxin reductase

uniprot entry name :

ADRO_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

33-451; Full length of Isoform 6

sequence length :

451

sequence :

TQEKTPQICVVGSGPAGFYTAQHLLKQHPQAHVDIYEKQ
PVPFGLVRFGVAPDHPEVKSYGAEDHRALEIPGEELPGV
CSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALD
VARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRR
GPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKE
VPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRF
FRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTG
DMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEG
RVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQD
LKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDA
EEVARGQGTGKPREKLVDPQEMLRLLGH

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cell Biology

products description :

Serves as the first electron transfer protein in all the mitochondrial P450 systems. Including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.

products references :

Human adrenodoxin reductase two mRNAs encoded by a single gene on chromosome 17cen-->q25 are expressed in steroidogenic tissues.Solish S.B., Picado-Leonard J., Morel Y., Kuhn R.W., Mohandas T.K., Hanukoglu I., Miller W.L.Proc. Natl. Acad. Sci. U.S.A. 85:7104-7108(1988) Cloning and sequence of the human adrenodoxin reductase gene.Lin D., Shi Y., Miller W.L.Proc. Natl. Acad. Sci. U.S.A. 87:8516-8520(1990) NIEHS SNPs programComplete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

ncbi gi num :

731184190

ncbi acc num :

NP_001244941.2

ncbi gb acc num :

NM_001258012.3

uniprot acc num :

P22570

ncbi mol weight :

61.47kD

ncbi pathways :

Biological Oxidations Pathway (1270189); Cytochrome P450 - Arranged By Substrate Type Pathway (1270191); Defective CYP11A1 Causes Adrenal Insufficiency, Congenital, With 46,XY Sex Reversal (AICSR) Pathway (1268980); Direct P53 Effectors Pathway (137939); Disease Pathway (1268854); Diseases Of Metabolism Pathway (1268939); Electron Transport From NADPH To Ferredoxin Pathway (1270222); Endogenous Sterols Pathway (1270192); Metabolic Disorders Of Biological Oxidation Enzymes Pathway (1268977); Metabolism Pathway (1269956)

uniprot summary :

FDXR: Serves as the first electron transfer protein in all the mitochondrial P450 systems. Including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver. Belongs to the ferredoxin--NADP reductase type 1 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Oxidoreductase; EC 1.18.1.6; Mitochondrial. Chromosomal Location of Human Ortholog: 17q25.1. Cellular Component: mitochondrial matrix; mitochondrion. Molecular Function: ferredoxin-NADP+ reductase activity; NADPH-adrenodoxin reductase activity; protein binding. Biological Process: C21-steroid hormone biosynthetic process; cholesterol metabolic process; generation of precursor metabolites and energy; steroid biosynthetic process; steroid metabolic process; sterol metabolic process; xenobiotic metabolic process

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1240

more info or order :

MyBioSource product webpage