Recombinant Human Islet cell autoantigen 1 | MyBioSource MBS954421 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Islet cell autoantigen 1

catalog :

MBS954421

quantity :

0.05 mg (Yeast)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS954421

products type :

Recombinant Protein

products full name :

Recombinant Human Islet cell autoantigen 1

products short name :

Islet cell autoantigen 1

products name syn :

69 kDa islet cell autoantigen; ICA69; Islet cell autoantigen p69; ICAp69; p69

other names :

islet cell autoantigen 1 isoform a; Islet cell autoantigen 1; islet cell autoantigen 1; islet cell autoantigen 1; 69 kDa islet cell autoantigen; ICA69; Islet cell autoantigen p69; ICAp69; p69

products gene name :

ICA1

other gene names :

ICA1; ICA1; ICA69; ICAp69; ICA69; ICAp69; p69

uniprot entry name :

ICA69_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-268

sequence length :

483

sequence :

MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIK
ATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIV
LYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATG
KALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTV
NRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQ
TQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATY
QTTLLHFWEKTSHTMAAIHES

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Neuroscience

products description :

May play a role in neurotransmitter secretion.

products references :

Islet cell autoantigen 69 kD (ICA69) . Molecular cloning and characterization of a novel diabetes-associated autoantigen.Pietropaolo M., Castano L., Babu S., Buelow R., Kuo Y.-L.S., Martin S., Martin A., Powers A.C., Prochazka M., Naggert J., Leiter E.H., Eisenbarth G.S.J. Clin. Invest. 92:359-371(1993) Cloning of human and rat p69 cDNA, a candidate autoimmune target in type 1 diabetes.Miyazaki I., Gaedigk R., Hui M.F., Cheung R.K., Morkowski J., Rajotte R.V., Dosch H.-M.Biochim. Biophys. Acta 1227:101-104(1994) Genomic organization and transcript analysis of ICAp69, a target antigen in diabetic autoimmunity.Gaedigk R., Karges W., Hui M.F., Scherer S.W., Dosch H.-M.Genomics 38:382-391(1996) A new transcript variant of human ICA69.Hoehne M., Lorscheider J., Schermer B., Benzing T. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003)

ncbi gi num :

209862841

ncbi acc num :

NP_001129492.1

ncbi gb acc num :

NM_001136020.2

uniprot acc num :

Q05084

ncbi mol weight :

35.6kD

ncbi pathways :

Type I Diabetes Mellitus Pathway (83095); Type I Diabetes Mellitus Pathway (507)

ncbi summary :

This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]

uniprot summary :

ICA1: May play a role in neurotransmitter secretion. Protein type: Unknown function. Chromosomal Location of Human Ortholog: 7p22. Cellular Component: cell junction; cytoplasm; cytosol; dendrite; Golgi apparatus; Golgi membrane; Golgi stack; perinuclear region of cytoplasm; secretory granule membrane; synaptic vesicle membrane. Molecular Function: protein binding; protein domain specific binding. Biological Process: neurotransmitter transport; regulation of insulin secretion; regulation of protein homodimerization activity

size1 :

0.05 mg (Yeast)

price1 :

185 USD

size2 :

0.2 mg (Yeast)

price2 :

420

size3 :

0.5 mg (Yeast)

price3 :

680

size4 :

1 mg (Yeast)

price4 :

1070

more info or order :

MyBioSource product webpage