product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human CD70 antigen
catalog :
MBS954408
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS954408
products type :
Recombinant Protein
products full name :
Recombinant Human CD70 antigen
products short name :
CD70 antigen
products name syn :
CD27 ligand; CD27-L; Tumor necrosis factor ligand superfamily member 7; CD70
other names :
CD70 antigen; CD70 antigen; CD70 antigen; CD70 molecule; CD27 ligand; CD27-L; Tumor necrosis factor ligand superfamily member 7; CD_antigen: CD70
products gene name :
CD70
other gene names :
CD70; CD70; CD27L; CD27LG; TNFSF7; TNLG8A; CD27L; CD27LG; TNFSF7; CD27-L
uniprot entry name :
CD70_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
39-193
sequence length :
193
sequence :
QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQG
GPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICS
STTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIAS
QRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cancer
products description :
Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
products references :
Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor.Goodwin R.G., Alderson M.R., Smith C.A., Armitage R.J., Vandenbos T., Jerzy R., Tough T.W., Schoenborn M.A., David-Smith T., Hennen K., Falk B., Cosman D., Baker E., Sutherland G.R., Grabstein K.H., Farrah T., Giri J.G., Beckmann M.P.Cell 73:447-456(1993)
ncbi gi num :
4507605
ncbi acc num :
NP_001243.1
ncbi gb acc num :
NM_001252.4
uniprot acc num :
P32970
ncbi mol weight :
19.1kD
ncbi pathways :
Cytokine Signaling In Immune System Pathway (1269310); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Immune System Pathway (1269170); TNFR2 Non-canonical NF-kB Pathway (1269329); TNFs Bind Their Physiological Receptors Pathway (1269332)
ncbi summary :
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
uniprot summary :
CD70: Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. Belongs to the tumor necrosis factor family. Protein type: Cytokine; Membrane protein, integral. Chromosomal Location of Human Ortholog: 19p13. Cellular Component: extracellular space; integral to plasma membrane; plasma membrane. Molecular Function: cytokine activity; protease binding; protein binding; receptor binding; tumor necrosis factor receptor binding. Biological Process: cell proliferation; cell-cell signaling; immune response; signal transduction; tumor necrosis factor-mediated signaling pathway
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
895
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1120
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!