protein

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5

MBS954373

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5

Proprotein convertase subtilisin/kexin type 5

Proprotein convertase 5; PC5; Proprotein convertase 6; PC6; Subtilisin-like proprotein convertase 6; SPC6; Subtilisin/kexin-like protease PC5

proprotein convertase subtilisin/kexin type 5 isoform 1 preproprotein; Proprotein convertase subtilisin/kexin type 5; proprotein convertase subtilisin/kexin type 5; proprotein convertase subtilisin/kexin type 5; Proprotein convertase 5; PC5; Proprotein convertase 6; PC6; Subtilisin-like proprotein convertase 6; SPC6; Subtilisin/kexin-like protease PC5

Pcsk5

Pcsk5; Pcsk5; PC5; PC6; SPC6; b2b585Clo; b2b1549Clo; PC5; PC6; SPC6

PCSK5_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

117-452; Partial.

452

DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIE
GAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCD
VNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTV
GIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSA
SWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVW
ASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYL
EECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSA
SAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNA
NDWKTNAAGFKVSHLYGFGLMDAE

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.

Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993) Identification and functional expression of a new member of the mammalian Kex2-like processing endoprotease family its striking structural similarity to PACE4.Nakagawa T., Hosaka M., Torii S., Watanabe T., Murakami K., Nakayama K.J. Biochem. 113:132-135(1993) cDNA structure of the mouse and rat subtilisin/kexin-like PC5 a candidate proprotein convertase expressed in endocrine and nonendocrine cells.Lusson J., Vieau D., Hamelin J., Day R., Chretien M., Seidah N.G.Proc. Natl. Acad. Sci. U.S.A. 90:6691-6695(1993) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) The isoforms of proprotein convertase PC5 are sorted to different subcellular compartments.De Bie I., Marcinkiewicz M., Malide D., Lazure C., Nakayama K., Bendayan M., Seidah N.G.J. Cell Biol. 135:1261-1275(1996) SPC4, SPC6, and the novel protease SPC7 are coexpressed with bone morphogenetic proteins at distinct sites during embryogenesis.Constam D.B., Calfon M., Robertson E.J.J. Cell Biol. 134:181-191(1996) Murine subtilisin-like proteinase SPC6 is expressed during embryonic implantation, somitogenesis, and skeletal formation.Rancourt S.L., Rancourt D.E.3.0.CO;2-5>Dev. Genet. 21:75-81(1997)

299523019

NP_001177412.1

NM_001190483.2

Q04592

52.68kD

NGF Processing Pathway (1324615); Signal Transduction Pathway (1324550); Signalling By NGF Pathway (1324614)

This gene encodes a subtilisin-like proprotein convertase that mediates posttranslational endoproteolytic processing of various proprotein substrates traversing the secretory pathway. The encoded protein is an inactive zymogen that undergoes autoproteolytic processing in the endoplasmic reticulum and the Golgi network to generate an active enzyme. Mice lacking the encoded protein die at an early embryonic stage. Conditional inactivation this gene in the epiblast but not in the extraembryonic tissue bypasses embryonic lethality but results in death at birth. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2015]

PCSK5: Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2 and CALD1. Belongs to the peptidase S8 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Protease; Membrane protein, integral; EC 3.4.21.-. Cellular Component: extracellular region; extracellular space; Golgi apparatus; integral to membrane; membrane; secretory granule. Molecular Function: endopeptidase activity; hydrolase activity; peptidase activity; peptide binding; serine-type endopeptidase activity; serine-type peptidase activity. Biological Process: anterior/posterior pattern formation; cytokine biosynthetic process; determination of left/right symmetry; embryo implantation; embryonic gut development; embryonic skeletal development; female pregnancy; heart development; kidney development; limb morphogenesis; peptide biosynthetic process; peptide hormone processing; protein processing; proteolysis; respiratory tube development; signal peptide processing; viral infectious cycle

0.05 mg (E-Coli)

180 USD

0.05 mg (Yeast)

260

0.2 mg (E-Coli)

490

0.2 mg (Yeast)

600

0.5 mg (E-Coli)

715