Recombinant Mouse Protein CYR61 | MyBioSource MBS954254 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Protein CYR61

catalog :

MBS954254

quantity :

0.05 mg (Yeast)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS954254

products type :

Recombinant Protein

products full name :

Recombinant Mouse Protein CYR61

products short name :

CYR61

products name syn :

3CH61CCN family member 1; Cysteine-rich angiogenic inducer 61; Insulin-like growth factor-binding protein 10; IBP-10; IGF-binding protein 10; IGFBP-10

other names :

protein CYR61; Protein CYR61; protein CYR61; cysteine rich protein 61; 3CH61; CCN family member 1; Cysteine-rich angiogenic inducer 61; Insulin-like growth factor-binding protein 10; IBP-10; IGF-binding protein 10; IGFBP-10

products gene name :

Cyr61

other gene names :

Cyr61; Cyr61; CCN1; Igfbp10; AI325051; Ccn1; Igfbp10; IBP-10; IGF-binding protein 10; IGFBP-10

uniprot entry name :

CYR61_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

25-379

sequence length :

379

sequence :

TCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQLNED
CSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEY
NSRIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLP
NLGCPNPRLVKVSGQCCEEWVCDEDSIKDSLDDQDDLLG
LDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLFNP
LHAHGQKCIVQTTSWSQCSKSCGTGISTRVTNDNPECRL
VKETRICEVRPCGQPVYSSLK

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-1/beta-5 and cell proliferation through integrin alpha-v/beta-3.

products references :

Expression of cyr61, a growth factor-inducible immediate-early gene.O'Brien T.P., Yang G.P., Sanders L., Lau L.F.Mol. Cell. Biol. 10:3569-3577(1990) Promoter function and structure of the growth factor-inducible immediate early gene cyr61.Latinkic B.V., O'Brien T.P., Lau L.F.Nucleic Acids Res. 19:3261-3267(1991) Adhesion of human skin fibroblasts to Cyr61 is mediated through integrin alpha 6beta 1 and cell surface heparan sulfate proteoglycans.Chen N., Chen C.-C., Lau L.F.J. Biol. Chem. 275:24953-24961(2000)

ncbi gi num :

6753594

ncbi acc num :

NP_034646.1

ncbi gb acc num :

NM_010516.2

uniprot acc num :

P18406

ncbi mol weight :

41.14kD

ncbi pathways :

Hypertrophy Model Pathway (198326); PodNet: Protein-protein Interactions In The Podocyte Pathway (755428); XPodNet - Protein-protein Interactions In The Podocyte Expanded By STRING Pathway (755427)

uniprot summary :

CYR61: Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up- regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3. Belongs to the CCN family. Protein type: Secreted; Secreted, signal peptide. Cellular Component: extracellular matrix; extracellular region; proteinaceous extracellular matrix. Molecular Function: extracellular matrix binding; growth factor binding; heparin binding; insulin-like growth factor binding; integrin binding. Biological Process: cell adhesion; cell-cell adhesion; cell-cell signaling; chemotaxis; extracellular matrix organization and biogenesis; intussusceptive angiogenesis; negative regulation of apoptosis; osteoblast differentiation; positive regulation of apoptosis; positive regulation of BMP signaling pathway; positive regulation of caspase activity; positive regulation of cell differentiation; positive regulation of cell migration; positive regulation of osteoblast differentiation; positive regulation of osteoblast proliferation; positive regulation of protein amino acid phosphorylation; positive regulation of protein kinase activity; positive regulation of transcription from RNA polymerase II promoter; regulation of cell growth; signal transduction

size1 :

0.05 mg (Yeast)

price1 :

185 USD

size2 :

0.2 mg (Yeast)

price2 :

420

size3 :

0.5 mg (Yeast)

price3 :

680

size4 :

1 mg (Yeast)

price4 :

1070

more info or order :

MyBioSource product webpage