LYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCST
FQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHF
SNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLF
HILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEE
DSPSHIKRTSHESA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Rat Lysosome-associated membrane glycoprotein 2 (Lamp2) | MBS955098
- Recombinant Mouse Apolipoprotein E | MBS955382
- Human Epidermal growth factor Like Domain Protein, Multiple 7, EGFL7 ELISA Kit
- Rat Alpha 2 Heremans Schmid Glycoprotein (AHSG) ELISA Kit | MBS705653
- Human Neurofilament protein L, NF-L ELISA Kit | MBS705750