product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2)
catalog :
MBS954144
quantity :
1 mg (E Coli Derived
price :
1770 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS954144
products type :
Recombinant Protein
products full name :
Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2)
products short name :
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2)
products name syn :
Recombinant 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2); 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II Including the followi
other names :
3 beta-hydroxysteroid dehydrogenase/Delta 5-- 4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-- 4-isomerase type 2; 3-beta-HSD II; 3 beta-hydroxysteroid dehydrogenase 2; hydroxysteroid dehydrogenase-2, delta -3-beta; 3 beta-hydroxysteroid dehydrogenase/Delta 5-- 4-isomerase type II; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II
products gene name syn :
Hsd3b2
other gene names :
Hsd3b2; Hsd3b2; 3-beta-HSD II
uniprot entry name :
3BHS2_MOUSE
host :
E Coli or Yeast
sequence positions :
2-373
sequence length :
373
sequence :
PGWSCLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFR
PETRKEFFNLETSIKVTVLEGDILDTQYLRRACQGISVV
IHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVP
AFIFSSSVDVAGPNSYKEIVLNGHEEECHESTWSDPYPY
SKKMAEKAVLAANGSMLKNGGTLQTCALRPMCIYGERSP
LISNIIIMALKHKGILRSFGKFNTANPVYVGNVAWAHIL
AARGLRDPKKSPNIQGEFYYISDDTPHQSFDDISYTLSK
EWGFCLDSSWSLPVPLLYWLAFLLETVSFLLSPIYRYIP
PFNRHLVTLSGSTFTFSYKKAQRDLGYEPLVSWEEAKQK
TSEWIGTLVEQHRETLDTKSQ
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Mus musculus (Mouse)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
162461559
ncbi acc num :
NP_694873.2
ncbi gb acc num :
NM_153193.3
uniprot acc num :
P26149
ncbi mol weight :
41,923 Da
ncbi pathways :
Androgen Biosynthesis Pathway 639936!!C19/C18-Steroid Hormone Biosynthesis, Pregnenolone = Androstenedione = Estrone Pathway 421781!!C19/C18-Steroid Hormone Biosynthesis, Pregnenolone = Androstenedione = Estrone Pathway 468268!!Glucocorticoid Mineralcorticoid Metabolism Pathway 198290!!Glucocorticoid Biosynthesis Pathway 639934!!Metabolism Pathway 639859!!Metabolism Of Lipids And Lipoproteins Pathway 639889!!Metabolism Of Steroid Hormones And Vitamins A And D Pathway 639932!!Mineralocorticoid Biosynthesis Pathway 639935!!Steroid Biosynthesis Pathway 198293
uniprot summary :
Function: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. Catalytic activity: A 3-beta-hydroxy-Delta(5)-steroid + NAD+ = a 3-oxo-Delta(5)-steroid + NADH.A 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid. Pathway: Lipid metabolism; steroid biosynthesis. Subcellular location: Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Tissue specificity: Liver and kidney. Sequence similarities: Belongs to the 3-beta-HSD family.
size :
1 mg (E Coli Derived)
price :
1770 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!