product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Interferon alpha-inducible protein 6
catalog :
MBS954093
quantity :
INQUIRE
price :
INQUIRE
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS954093
products type :
Recombinant Protein
products full name :
Recombinant Human Interferon alpha-inducible protein 6
products short name :
Interferon alpha-inducible protein 6
products name syn :
Interferon-induced protein 6-16; Ifi-6-16
other names :
interferon alpha-inducible protein 6 isoform a; Interferon alpha-inducible protein 6; interferon alpha-inducible protein 6; interferon, alpha-inducible protein 6; Interferon-induced protein 6-16; Ifi-6-16
products gene name :
IFI6
other gene names :
IFI6; IFI6; 6-16; G1P3; FAM14C; IFI616; IFI-6-16; G1P3; Ifi-6-16
uniprot entry name :
IFI6_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
24-130
sequence length :
130
sequence :
GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFT
GAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGA
GGSSVVIGNIGALMGYATHKYLDSEEDEE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Metabolism
products references :
Characterization of a human gene inducible by alpha- and beta-interferons and its expression in mouse cells.Kelly J.M., Porter A.C.G., Chernajovsky Y., Gilbert C.S., Stark G.R., Kerr I.M.EMBO J. 5:1601-1606(1986)
ncbi gi num :
13259552
ncbi acc num :
NP_002029.3
ncbi gb acc num :
NM_002038.3
uniprot acc num :
P09912
ncbi mol weight :
12.3kD
ncbi pathways :
Cytokine Signaling In Immune System Pathway (1269310); Immune System Pathway (1269170); Interferon Signaling Pathway (1269311); Interferon Alpha/beta Signaling Pathway (1269312); Type II Interferon Signaling (IFNG) Pathway (198918)
ncbi summary :
This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq, Jul 2008]
uniprot summary :
IFI6: first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq, Jul 2008]. Protein type: Membrane protein, multi-pass; Membrane protein, integral; Apoptosis. Chromosomal Location of Human Ortholog: 1p35. Cellular Component: integral to membrane; mitochondrion; plasma membrane. Molecular Function: protein binding. Biological Process: cytokine and chemokine mediated signaling pathway; immune response; negative regulation of caspase activity; negative regulation of mitochondrial depolarization; release of cytochrome c from mitochondria
size1 :
INQUIRE
price1 :
INQUIRE
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!