Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog | MyBioSource MBS954058 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

catalog :

MBS954058

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS954058

products type :

Recombinant Protein

products full name :

Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

products short name :

Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

products name syn :

Bcl-2-related protein EAT/mcl1

other names :

induced myeloid leukemia cell differentiation protein Mcl-1 homolog; Induced myeloid leukemia cell differentiation protein Mcl-1 homolog; induced myeloid leukemia cell differentiation protein Mcl-1 homolog; myeloid cell leukemia sequence 1; Bcl-2-related protein EAT/mcl1

products gene name :

Mcl1

other gene names :

Mcl1; Mcl1; Mcl-1; AW556805

uniprot entry name :

MCL1_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-308

sequence length :

331

sequence :

MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAK
ARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRL
HKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGK
RPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLY
RQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLR
RVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHV
FKDGVTNWGRIVTLISFGAFV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 2 has antiapoptotic activity.

products references :

Up-regulated expression of murine Mcl1/EAT, a bcl-2 related gene, in the early stage of differentiation of murine embryonal carcinoma cells and embryonic stem cells.Okita H., Umezawa A., Suzuki A., Hata J.Biochim. Biophys. Acta 1398:335-341(1998) MCL-1V, a novel mouse antiapoptotic MCL-1 variant, generated by RNA splicing at a non-canonical splicing pair.Kojima S., Hyakutake A., Koshikawa N., Nakagawara A., Takenaga K.Biochem. Biophys. Res. Commun. 391:492-497(2010) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mcl-1 is an immediate-early gene activated by the granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling pathway and is one component of the GM-CSF viability response.Chao J.-R., Wang J.-M., Lee S.-F., Peng H.-W., Lin Y.-H., Chou C.-H., Li J.-C., Huang H.-M., Chou C.-K., Kuo M.-L., Yen J.J.-Y., Yang-Yen H.-F.Mol. Cell. Biol. 18:4883-4898(1998) Glycogen synthase kinase-3 regulates mitochondrial outer membrane permeabilization and apoptosis by destabilization of MCL-1.Maurer U., Charvet C., Wagman A.S., Dejardin E., Green D.R.Mol. Cell 21:749-760(2006) Pro-apoptotic activity of inhibitory PAS domain protein (IPAS) , a negative regulator of HIF-1, through binding to pro-survival Bcl-2 family proteins.Torii S., Goto Y., Ishizawa T., Hoshi H., Goryo K., Yasumoto K., Fukumura H., Sogawa K.Cell Death Differ. 18:1711-1725(2011) Solution structure of prosurvival Mcl-1 and characterization of its binding by proapoptotic BH3-only ligands.Day C.L., Chen L., Richardson S.J., Harrison P.J., Huang D.C.S., Hinds M.G.J. Biol. Chem. 280:4738-4744(2005) Structure of the BH3 domains from the p53-inducible BH3-only proteins Noxa and Puma in complex with Mcl-1.Day C.L., Smits C., Fan F.C., Lee E.F., Fairlie W.D., Hinds M.G.J. Mol. Biol. 380:958-971(2008)

ncbi gi num :

6678824

ncbi acc num :

NP_032588.1

ncbi gb acc num :

NM_008562.3

uniprot acc num :

P97287

ncbi mol weight :

48.9kD

ncbi pathways :

Apoptosis Pathway (198339); IL-7 Signaling Pathway (198324); Jak-STAT Signaling Pathway (83274); Jak-STAT Signaling Pathway (488); MicroRNAs In Cancer Pathway (852715); MicroRNAs In Cancer Pathway (852928); PI3K-Akt Signaling Pathway (692242); PI3K-Akt Signaling Pathway (692979)

uniprot summary :

MCL1: a myeloid cell leukemia protein of the Bcl-2 family of proteins. Two alternatively spliced transcripts encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing. Protein type: Inhibitor; Channel, misc.; Mitochondrial; Apoptosis; Membrane protein, integral. Cellular Component: cytoplasm; cytosol; integral to membrane; membrane; mitochondrial matrix; mitochondrial outer membrane; mitochondrion; nucleus. Molecular Function: BH domain binding; BH3 domain binding; protein binding; protein dimerization activity; protein heterodimerization activity; protein homodimerization activity. Biological Process: apoptosis; apoptotic mitochondrial changes; cell differentiation; DNA damage response, signal transduction resulting in induction of apoptosis; multicellular organismal development; negative regulation of apoptosis; regulation of apoptosis; response to cytokine stimulus

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage