protein

Recombinant Human Collagen alpha-1(XVIII) chain

MBS954038

0.05 mg (Yeast)

190 USD

Recombinant Protein

Recombinant Human Collagen alpha-1(XVIII) chain

Collagen alpha-1(XVIII) chain

collagen alpha-1(XVIII) chain isoform 1 preproprotein; Collagen alpha-1(XVIII) chain; collagen alpha-1(XVIII) chain; collagen type XVIII alpha 1

COL18A1

COL18A1; COL18A1; KS; KNO; KNO1

COIA1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1578-1754, The partial of Endostatin chain

1754

QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGT
FRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWE
ALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGS
DPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSA
ASCHHAYIVLCIENSFMTASK

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cell Adhesion

COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube. Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.

Complete primary structure of two variant forms of human type XVIII collagen and tissue-specific differences in the expression of the corresponding transcripts.Saarela J., Ylikarppa R., Rehn M., Purmonen S., Pihlajaniemi T.Matrix Biol. 16:319-328(1998) Characterization of the human type XVIII collagen gene and proteolytic processing and tissue location of the variant containing a frizzled motif.Elamaa H., Snellman A., Rehn M., Autio-Harmainen H., Pihlajaniemi T.Matrix Biol. 22:427-442(2003) The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000) Cloning of cDNA and genomic DNA encoding human type XVIII collagen and localization of the alpha 1(XVIII) collagen gene to mouse chromosome 10 and human chromosome 21.Oh S.P., Warman M.L., Seldin M.F., Cheng S., Knoll J.H., Timmons S., Olsen B.R.Genomics 19:494-499(1994) Inhibition effect in vitro of purified endostatin expressed in Pichia pastoris.Feng Y., Cui L.B., Liu C.X., Ma Q.J.Sheng Wu Gong Cheng Xue Bao 17:278-282(2001) Cloning and expression of human endostatin gene in Escherichia coli.Zhi-Yong H., Biao L., Wei-Jie Z., Xiang-Fu W. Endostatin promotes delayed secondary damage following traumatic brain injury.Deininger M.H., Trautmann K., Schluesener H.J.No evidence for locus heterogeneity in Knobloch syndrome.Aldahmesh M.A., Khan A.O., Mohamed J.Y., Levin A.V., Wuthisiri W., Lynch S., McCreery K., Alkuraya F.S.J. Med. Genet. 50:565-566(2013) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Zinc-dependent dimers observed in crystals of human endostatin.Ding Y.-H., Javaherian K., Lo K.-M., Chopra R., Boehm T., Lanciotti J., Harris B.A., Li Y., Shapiro R., Hohenester E., Timpl R., Folkman J., Wiley D.C.Proc. Natl. Acad. Sci. U.S.A. 95:10443-10448(1998) Collagen XVIII, containing an endogenous inhibitor of angiogenesis and tumor growth, plays a critical role in the maintenance of retinal structure and in neural tube closure.Sertie A.L., Sossi V., Camargo A.A., Zatz M., Brahe C., Passos-Bueno M.R.Hum. Mol. Genet. 9:2051-2058(2000) A polymorphism in endostatin, an angiogenesis inhibitor, predisposes for the development of prostatic adenocarcinoma.Iughetti P., Suzuki O., Godoi P.H., Alves V.A., Sertie A.L., Zorick T., Soares F., Camargo A.A., Moreira E.S., di Loreto C., Moreira-Filho C.A., Simpson A., Oliva G., Passos-Bueno M.R.Cancer Res. 61:7375-7378(2001) Knobloch syndrome novel mutations in COL18A1, evidence for genetic heterogeneity, and a functionally impaired polymorphism in endostatin.Menzel O., Bekkeheien R.C.J., Reymond A., Fukai N., Boye E., Kosztolanyi G., Aftimos S., Deutsch S., Scott H.S., Olsen B.R., Antonarakis S.E., Guipponi M.Hum. Mutat. 23:77-84(2004) DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.Ley T.J., Mardis E.R., Ding L., Fulton B., McLellan M.D., Chen K., Dooling D., Dunford-Shore B.H., McGrath S., Hickenbotham M., Cook L., Abbott R., Larson D.E., Koboldt D.C., Pohl C., Smith S., Hawkins A., Abbott S., Locke D., Hillier L.W., Miner T., Fulton L., Magrini V., Wylie T., Glasscock J., Conyers J., Sander N., Shi X., Osborne J.R., Minx P., Gordon D., Chinwalla A., Zhao Y., Ries R.E., Payton J.E., Westervelt P., Tomasson M.H., Watson M., Baty J., Ivanovich J., Heath S., Shannon W.D., Nagarajan R., Walter M.J., Link D.C., Graubert T.A., DiPersio J.F., Wilson R.K.Nature 456:66-72(2008)

110611235

NP_085059.2

NM_030582.3

P39060

21.3kD

Activation Of Matrix Metalloproteinases Pathway (1270258); Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1270247); Collagen Biosynthesis And Modifying Enzymes Pathway (1270246); Collagen Degradation Pathway (1270259); Collagen Formation Pathway (1270245); Degradation Of The Extracellular Matrix Pathway (1270257); Direct P53 Effectors Pathway (137939); Extracellular Matrix Organization Pathway (1270244); FOXA1 Transcription Factor Network Pathway (137979); Integrin Cell Surface Interactions Pathway (1270260)

This gene encodes the alpha chain of type XVIII collagen. This collagen is one of the multiplexins, extracellular matrix proteins that contain multiple triple-helix domains (collagenous domains) interrupted by non-collagenous domains. A long isoform of the protein has an N-terminal domain that is homologous to the extracellular part of frizzled receptors. Proteolytic processing at several endogenous cleavage sites in the C-terminal domain results in production of endostatin, a potent antiangiogenic protein that is able to inhibit angiogenesis and tumor growth. Mutations in this gene are associated with Knobloch syndrome. The main features of this syndrome involve retinal abnormalities, so type XVIII collagen may play an important role in retinal structure and in neural tube closure. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

COL18A1: COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube. Defects in COL18A1 are a cause of Knobloch syndrome type 1 (KNO1). An autosomal recessive disorder defined by the occurrence of high myopia, vitreoretinal degeneration with retinal detachment, macular abnormalities and occipital encephalocele. Belongs to the multiplexin collagen family. 3 isoforms of the human protein are produced by alternative promoter. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 21q22.3. Cellular Component: basement membrane; collagen; endoplasmic reticulum lumen; extracellular matrix; extracellular region; extracellular space. Molecular Function: identical protein binding; metal ion binding; protein binding; structural molecule activity. Biological Process: angiogenesis; cell adhesion; collagen catabolic process; endothelial cell morphogenesis; extracellular matrix disassembly; extracellular matrix organization and biogenesis; negative regulation of cell proliferation; organ morphogenesis; positive regulation of cell migration; positive regulation of cell proliferation; response to drug; response to hydrostatic pressure; visual perception. Disease: Knobloch Syndrome 1

0.05 mg (Yeast)

190 USD

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750

0.05 mg (Baculovirus)

925

0.05 mg (Mammalian-Cell)

1145