Recombinant Human CD59 glycoprotein | MyBioSource MBS953357 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human CD59 glycoprotein

catalog :

MBS953357

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS953357

products type :

Recombinant Protein

products full name :

Recombinant Human CD59 glycoprotein

products short name :

CD59 glycoprotein

products name syn :

1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20; MAC-inhibitory protein; MAC-IP; MEM43 antigen; Membrane attack complex inhibition factor; MACIF; Membrane inhibitor of reactive lysis; MIRL; Protectin; CD59

other names :

CD59 glycoprotein preproprotein; CD59 glycoprotein; CD59 glycoprotein; CD59 molecule; 1F5 antigen; 20 kDa homologous restriction factor; HRF-20; HRF20; MAC-inhibitory protein; MAC-IP; MEM43 antigen; Membrane attack complex inhibition factor; MACIF; Membrane inhibitor of reactive lysis; MIRL; Protectin; CD_antigen: CD59

products gene name :

CD59

other gene names :

CD59; CD59; 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20; MIC11; MIN1; MIN2; MIN3; MSK21; HRF-20; HRF20; MAC-IP; MACIF; MIRL

uniprot entry name :

CD59_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

26-102

sequence length :

128

sequence :

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKC
WKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cardiovascular

products description :

Potent inhibitor of the complent membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.

products references :

CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.Davies A., Simmons D.L., Hale G., Harrison R.A., Tighe H., Lachmann P.J., Waldmann H.J. Exp. Med. 170:637-654(1989)

ncbi gi num :

10835165

ncbi acc num :

NP_000602.1

ncbi gb acc num :

NM_000611.5

uniprot acc num :

P13987

ncbi mol weight :

36.4kD

ncbi pathways :

Arf6 Trafficking Events Pathway (137954); Asparagine N-linked Glycosylation Pathway (1268714); COPI-mediated Anterograde Transport Pathway (1339109); COPII (Coat Protein 2) Mediated Vesicle Transport Pathway (1268727); Cargo Concentration In The ER Pathway (1309087); Complement And Coagulation Cascades Pathway (83073); Complement And Coagulation Cascades Pathway (484); Complement Cascade Pathway (1269241); ER To Golgi Anterograde Transport Pathway (1268726); Hematopoietic Cell Lineage Pathway (83078)

ncbi summary :

This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]

uniprot summary :

CD59: Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. Defects in CD59 are the cause of CD59 deficiency (CD59D). Protein type: Membrane protein, GPI anchor. Chromosomal Location of Human Ortholog: 11p13. Cellular Component: anchored to external side of plasma membrane; cell surface; compact myelin; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; extracellular space; focal adhesion; Golgi membrane; membrane; plasma membrane; sarcolemma; vesicle. Molecular Function: complement binding; protein binding. Biological Process: blood coagulation; cell surface receptor linked signal transduction; cellular protein metabolic process; COPII coating of Golgi vesicle; ER to Golgi vesicle-mediated transport; innate immune response; negative regulation of activation of membrane attack complex; negative regulation of apoptosis; positive regulation of T cell proliferation; post-translational protein modification; protein amino acid N-linked glycosylation via asparagine; regulation of complement activation. Disease: Hemolytic Anemia, Cd59-mediated, With Or Without Immune-mediated Polyneuropathy

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage