product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Ephrin-A5
catalog :
MBS953260
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS953260
products type :
Recombinant Protein
products full name :
Recombinant Rat Ephrin-A5
products short name :
Ephrin-A5
products name syn :
AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7
other names :
ephrin-A5; Ephrin-A5; ephrin-A5; ephrin A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7
products gene name :
Efna5
other gene names :
Efna5; Efna5; Lerk7; Eplg7; Lerk7; LERK-7
uniprot entry name :
EFNA5_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-203
sequence length :
228
sequence :
QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLD
VFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFK
RWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYF
YISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFD
VNDKVENSLEPADDTVHESAEPSRGEN
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.
products references :
Cloning of AL-1, a ligand for an Eph-related tyrosine kinase receptor involved in axon bundle formation.Winslow J.W., Moran P., Valverde J., Shih A., Yuan J.Q., Wong S.C., Tsai S.P., Goddard A., Henzel W.J., Hefti F., Beck K.D., Caras I.W.Neuron 14:973-981(1995) rLERK7, rat ligand for Eph-related receptor tyrosine kinase.Li Y.Y., McTiernan C.F., Feldman A.M.
ncbi gi num :
16758778
ncbi acc num :
NP_446355.1
ncbi gb acc num :
NM_053903.1
uniprot acc num :
P97605
ncbi mol weight :
25.3kD
ncbi pathways :
Axon Guidance Pathway (83457); Axon Guidance Pathway (476); PI3K-Akt Signaling Pathway (692247); PI3K-Akt Signaling Pathway (692979); Rap1 Signaling Pathway (869320); Rap1 Signaling Pathway (878042); Ras Signaling Pathway (869318)
ncbi summary :
Ephrin-related tryosine-kinase receptor, designated ephrin-A5 based on structure and sequence relationships; implicated in nervous system development, particularly with axon pathfinding and fasciculation [RGD, Feb 2006]
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!