VSIGYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQE
KAHNQDLGLAGSCLARFST

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- AMOTL2, ID (Leman Coiled-coil Protein, LCCP, Angiomotin-like Protein 2, KIAA0989 ...
- HSGT1 (Ecdysoneless Homolog, ECD, GCR2, hSGT1, Protein Ecdysoneless Homolog, Pro ...
- NME1 (Nucleoside Diphosphate Kinase A, NDP Kinase A, NDK A, Tumor Metastatic Pro ...
- SMYD5, CT (SET and MYND Domain-containing Protein 5, Retinoic Acid-induced Prote ...
- Heat Shock Protein 70, Geodia cydonium (HSP70, GCHSP70) | MBS628418