product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Proto-oncogene Wnt-3
catalog :
MBS953174
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS953174
products type :
Recombinant Protein
products full name :
Recombinant Mouse Proto-oncogene Wnt-3
products short name :
Proto-oncogene Wnt-3
products name syn :
Proto-oncogene Int-4
other names :
proto-oncogene Wnt-3; Proto-oncogene Wnt-3; proto-oncogene Wnt-3; wingless-type MMTV integration site family, member 3; Proto-oncogene Int-4
products gene name :
Wnt3
other gene names :
Wnt3; Wnt3; Int-4; Wnt-3; Int-4; Wnt-3
uniprot entry name :
WNT3_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-355
sequence length :
355
sequence :
GYPIWWSLALGQQYTSLASQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLA
IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTI
CGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARE
NRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCE
VKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGW
VETLRAKYALFKPPTERDLVY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Ligand for mbers of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
products references :
Wnt-3, a gene activated by proviral insertion in mouse mammary tumors, is homologous to int-1/Wnt-1 and is normally expressed in mouse embryos and adult brain.Roelink H., Wagenaar E., Lopes da Silva S., Nusse R.Proc. Natl. Acad. Sci. U.S.A. 87:4519-4523(1990) The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.Tanaka K., Okabayashi H., Asashima M., Perrimon N., Kadowaki T.Eur. J. Biochem. 267:4300-4311(2000) Reciprocal regulation of Wnt and Gpr177/mouse Wntless is required for embryonic axis formation.Fu J., Jiang M., Mirando A.J., Yu H.-M., Hsu W.Proc. Natl. Acad. Sci. U.S.A. 106:18598-18603(2009)
ncbi gi num :
6678593
ncbi acc num :
NP_033547.1
ncbi gb acc num :
NM_009521.2
uniprot acc num :
P17553
ncbi mol weight :
53.44kD
ncbi pathways :
Basal Cell Carcinoma Pathway (83306); Basal Cell Carcinoma Pathway (525); ESC Pluripotency Pathways (198374); HTLV-I Infection Pathway (373903); HTLV-I Infection Pathway (373889); Hedgehog Signaling Pathway (83260); Hedgehog Signaling Pathway (474); Hippo Signaling Pathway (749786); Hippo Signaling Pathway (750388); Melanogenesis Pathway (83289)
uniprot summary :
WNT3: Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Defects in WNT3 are the cause of autosomal recessive tetra-amelia (ARTTRA). Tetra-amelia is a rare human genetic disorder characterized by complete absence of all four limbs and other anomalies such as craniofacial, nervous system, pulmonary, skeletal and urogenital defects. Belongs to the Wnt family. Protein type: Secreted; Oncoprotein; Secreted, signal peptide. Cellular Component: cytoplasm; extracellular region; extracellular space; proteinaceous extracellular matrix. Molecular Function: frizzled binding; protein binding; protein domain specific binding; receptor binding. Biological Process: anatomical structure formation; anterior/posterior axis specification; anterior/posterior pattern formation; axon guidance; cell fate commitment; cell morphogenesis; cell-cell signaling; dorsal/ventral axis specification; embryonic forelimb morphogenesis; embryonic hindlimb morphogenesis; gamete generation; limb bud formation; limb development; mesoderm formation; multicellular organismal development; negative regulation of axon extension involved in axon guidance; organ morphogenesis; positive regulation of collateral sprouting in the absence of injury; positive regulation of Wnt receptor signaling pathway; signal transduction; Spemann organizer formation at the anterior end of the primitive streak; Wnt receptor signaling pathway; Wnt receptor signaling pathway through beta-catenin
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!