This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bovine Gonadotropin-releasing hormone receptor (GNRHR)
catalog :
MBS953135
quantity :
1 mg (E Coli Derived
price :
1670 USD
product information
catalog number :
MBS953135
products type :
Recombinant Protein
products full name :
Recombinant Bovine Gonadotropin-releasing hormone receptor (GNRHR)
products short name :
Gonadotropin-releasing hormone receptor (GNRHR)
products name syn :
Recombinant Gonadotropin-releasing hormone receptor (GNRHR); Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
other names :
gonadotropin-releasing hormone receptor; Gonadotropin-releasing hormone receptor; gonadotropin-releasing hormone receptor; gnRH-R; gnRH receptor; luteinizing-releasing hormone receptor; gonadotropin-releasing hormone receptor<
products gene name syn :
GNRHR
other gene names :
GNRHR; GNRHR; GnRH receptor; GnRH-R
uniprot entry name :
GNRHR_BOVIN
host :
E Coli or Yeast
sequence positions :
1-328
sequence length :
328
sequence :
MANSDSPEQNENHCSAINSSIPLTPGSLPTLTLSGKIRV
TVTFFLFLLSTIFNTSFLLKLQNWTQRKEKRKKLSRMKL
LLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVL
SYLKLFSMYAPAFMMVVISLDRSLAITKPLAVKSNSKLG
QFMIGLAWLLSSIFAGPQLYIFGMIHLADDSGQTEGFSQ
CVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMVICNAKI
IFTLTRVLHQDPHKLQLNQSKNNIPRARLRTLKMTVAFA
TSFTVCWTPYYVLGIWYWFDPDMVNRVSDPVNHFFFLFA
FLNPCFDPLIYGYFSL
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Bos taurus (Bovine)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
29135325
ncbi acc num :
NP_803480.1
ncbi gb acc num :
NM_177514.2
uniprot acc num :
P32236
ncbi mol weight :
37,741 Da
ncbi pathways :
Class A/1 (Rhodopsin-like Receptors) Pathway 636620!!G Alpha (q) Signalling Events Pathway 636651!!GPCR Downstream Signaling Pathway 636647!!GPCR Ligand Binding Pathway 636619!!Gastrin-CREB Signalling Pathway Via PKC And MAPK 636668!!GnRH Signaling Pathway 84330!!GnRH Signaling Pathway 502!!Hormone Ligand-binding Receptors Pathway 636633!!Neuroactive Ligand-receptor Interaction Pathway 84292!!Neuroactive Ligand-receptor Interaction Pathway 462
uniprot summary :
Function: Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Subcellular location: Cell membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
size :
1 mg (E Coli Derived)
price :
1670 USD
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!