catalog number :
MBS953061
products type :
Recombinant Protein
products full name :
Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3
products short name :
Basic leucine zipper transcriptional factor ATF-like 3
products name syn :
Jun dimerization protein 1; JDP-1
other names :
basic leucine zipper transcriptional factor ATF-like 3; Basic leucine zipper transcriptional factor ATF-like 3; basic leucine zipper transcriptional factor ATF-like 3; basic leucine zipper transcription factor, ATF-like 3; Jun dimerization protein 1; JDP-1
products gene name :
Batf3
other gene names :
Batf3; Batf3; Jdp1; Jdp1; B-ATF-3; JDP-1
uniprot entry name :
BATF3_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-133
sequence :
MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNR
VAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLK
EELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSA
HDAPDHPSFIWLGTLV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens.
products references :
Isolation of an AP-1 repressor by a novel method for detecting protein-protein interactions.Aronheim A., Zandi E., Hennemann H., Elledge S.J., Karin M.Mol. Cell. Biol. 17:3094-3102(1997)
ncbi acc num :
NP_068637.1
ncbi gb acc num :
NM_021865.1
ncbi mol weight :
19.22kD
ncbi summary :
human homolog is Jun dimerization protein p21SNFT which is a DNA binding basic leucine zipper protein [RGD, Feb 2006]