protein

Recombinant Human Signal transducer and activator of transcription 3

MBS953021

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Signal transducer and activator of transcription 3

Signal transducer and activator of transcription 3

Acute-phase response factor

signal transducer and activator of transcription 3 isoform 2; Signal transducer and activator of transcription 3; signal transducer and activator of transcription 3; signal transducer and activator of transcription 3 (acute-phase response factor); Acute-phase response factor

STAT3

STAT3; STAT3; APRF; HIES; ADMIO

STAT3_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

50-240

722

ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQ
FLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGG
QANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVE
NLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQ
MLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Immunology

Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the interleukin-6 (IL-6)-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA. Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity. Plays an important role in host defense in methicillin-resistant S. aureus lung infection by regulating the expression of the antimicrobial lectin REG3G.

Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.Akira S., Nishio Y., Inoue M., Wang X.-J., Wei S., Matsusaka T., Yoshida K., Sudo T., Naruto M., Kishimoto T.Cell 77:63-71(1994) Highly conserved amino-acid sequence between murine STAT3 and a revised human STAT3 sequence.Della Pietra L., Bressan A., Pezzotti A., Serlupi-Crescenzi O.Gene 213:119-124(1998) Methods for treating chronic kidney disease.Feinstein E., Adamsky S., Erlich S., Molitoris B.Patent number EP2440214, 18-APR-2012Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) SeattleSNPs variation discovery resourceDNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006)

21618338

NP_003141.2

NM_003150.3

P40763

38.2kD

AGE-RAGE Signaling Pathway In Diabetic Complications (1319988); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); AGE/RAGE Pathway (698754); Acute Myeloid Leukemia Pathway (83117); Acute Myeloid Leukemia Pathway (529); Adipocytokine Signaling Pathway (83093); Adipocytokine Signaling Pathway (505); Adipogenesis Pathway (198832); Androgen Receptor Signaling Pathway (198806); B Cell Receptor Signaling Pathway (198909)

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2015]

STAT3: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of many cytokines and growth-factor receptors. Constitutively active in a number of human tumors. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described. Protein type: Motility/polarity/chemotaxis; DNA-binding; Nuclear receptor co-regulator; Transcription factor. Chromosomal Location of Human Ortholog: 17q21.31. Cellular Component: cytoplasm; cytosol; mitochondrial inner membrane; nuclear chromatin; nucleoplasm; nucleus; plasma membrane. Molecular Function: CCR5 chemokine receptor binding; chromatin DNA binding; DNA binding; glucocorticoid receptor binding; identical protein binding; ligand-dependent nuclear receptor activity; protein binding; protein dimerization activity; protein kinase binding; protein phosphatase binding; signal transducer activity; transcription factor activity; transcription factor binding. Biological Process: acute-phase response; aging; astrocyte differentiation; cell motility; cell proliferation; cellular response to hormone stimulus; cytokine and chemokine mediated signaling pathway; eating behavior; eye photoreceptor cell differentiation; glucose homeostasis; intracellular receptor-mediated signaling pathway; JAK-STAT cascade; leptin-mediated signaling pathway; negative regulation of apoptosis; negative regulation of cell proliferation; negative regulation of glycolysis; negative regulation of transcription from RNA polymerase II promoter; nerve growth factor receptor signaling pathway; nervous system development; phosphorylation; positive regulation of Notch signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein import into nucleus; radial glial cell differentiation; regulation of cell cycle; regulation of mitochondrial membrane permeability; regulation of multicellular organism growth; regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; response to drug; response to estradiol stimulus; response to ethanol; sexual reproduction; signal transduction; somatic stem cell maintenance; thermoregulation; transcription from RNA polymerase II promoter; viral reproduction. Disease: Autoimmune Disease, Multisystem, Infantile-onset; Hyper-ige Recurrent Infection Syndrome, Autosomal Dominant

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

0.05 mg (Baculovirus)

1585