protein

Recombinant Human Probable global transcription activator SNF2L2

MBS953002

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Human Probable global transcription activator SNF2L2

Probable global transcription activator SNF2L2

ATP-dependent helicase SMAR; CA2BRG1-associated factor 190B

probable global transcription activator SNF2L2 isoform a; Probable global transcription activator SNF2L2; ATP-dependent helicase SMARCA2; BRG1-associated factor 190B; BAF190B; Protein brahma homolog; hBRM; SNF2-alpha; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2

SMARCA2

SMARCA2; BAF190B; hBRM

SMCA2_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

700-1216

1,572

SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSL
YNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYL
IIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVP
QLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHR
MKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWAL
LNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETIL
IIRRLHKVLRPFLLRRLKKEV

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neuroscience

Transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a st/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural st/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural st cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

A human homologue of Saccharomyces cerevisiae SNF2/SWI2 and Drosophila brm genes potentiates transcriptional activation by the glucocorticoid receptor.Muchardt C., Yaniv M.EMBO J. 12:4279-4290(1993) Two human homologues of Saccharomyces cerevisiae SWI2/SNF2 and Drosophila brahma are transcriptional coactivators cooperating with the estrogen receptor and the retinoic acid receptor.Chiba H., Muramatsu M., Nomoto A., Kato H.Nucleic Acids Res. 22:1815-1820(1994) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

574957243

NP_001276325.1

NM_001289396.1

P51531

75.7kD

C-MYB Transcription Factor Network Pathway (138073); Chromatin Modifying Enzymes Pathway (1270434); Chromatin Organization Pathway (1270433); E2F Transcription Factor Network Pathway (137934); RB In Cancer Pathway (920977); RMTs Methylate Histone Arginines Pathway (1270439); Regulation Of Androgen Receptor Activity Pathway (138027)

SMARCA2: an enzyme with ATP-dependent DNA helicase activity. A transcriptional coactivator that cooperates with nuclear hormone receptors to potentiate transcriptional activation. Binds TOPBP1. Belongs to the SNF2/RAD54 helicase family. Two alternatively spliced human isoforms have been described. Protein type: EC 3.6.1.-; Transcription, coactivator/corepressor; EC 3.6.4.-; Helicase; Nuclear receptor co-regulator. Chromosomal Location of Human Ortholog: 9p22.3. Cellular Component: intermediate filament cytoskeleton; intracellular membrane-bound organelle; nuclear chromatin; nucleoplasm; nucleus; SWI/SNF complex. Molecular Function: ATP binding; chromatin binding; DNA-dependent ATPase activity; helicase activity; histone binding; protein binding; transcription coactivator activity. Biological Process: chromatin remodeling; establishment and/or maintenance of chromatin architecture; negative regulation of cell growth; negative regulation of cell proliferation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; nervous system development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; spermatid development; transcription, DNA-dependent. Disease: Nicolaides-baraitser Syndrome

0.05 mg (E-Coli)

185 USD

0.05 mg (Yeast)

185

0.2 mg (E-Coli)

420

0.2 mg (Yeast)

420

0.5 mg (E-Coli)

680