protein

Recombinant Mouse Neurofilament light polypeptide

MBS952971

0.05 mg (Yeast)

190 USD

Recombinant Protein

Recombinant Mouse Neurofilament light polypeptide

Neurofilament light polypeptide

68 kDa neurofilament protein; Neurofilament triplet L protein

neurofilament light polypeptide; Neurofilament light polypeptide; neurofilament light polypeptide; neurofilament, light polypeptide; 68 kDa neurofilament protein; Neurofilament triplet L protein

Nefl

Nefl; Nefl; Nfl; NF-L; NF68; CMT2E; AI847934; Nf68; Nfl; NF-L

NFL_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

2-543; Full length.

543

SSFGYDPYFSTSYKRRYVETPRVHISSVRSGYSTARSAY
SSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAI
SNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVL
EAELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEK
QALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEAR
KGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQ
AQIQYAQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNM
QNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLL
KAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTI
NKLENELRSTKSEMARYLKEYQDLLNVKMALDIEIAAYR
KLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYSGLQS
SSYLMSARSFPAYYTSHVQEEQTEVEETIEATKAEEAKD
EPPSEGEAEEEEKEKEEGEEEEGAEEEEAAKDESEDTKE
EEEGGEGEEEDTKESEEEEKKEESAGEEQVAKKKD

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.

Cloning and developmental expression of the murine neurofilament gene family.Julien J.-P., Meyer D., Flavell D., Hurst J., Grosveld F.Brain Res. 387:243-250(1986) Anomalous placement of introns in a member of the intermediate filament multigene family an evolutionary conundrum.Lewis S.A., Cowan N.J.Mol. Cell. Biol. 6:1529-1534(1986) Jensen K.H., Brown A. Structure of the 68-kDa neurofilament gene and regulation of its expression.Nakahira K., Ikenaka K., Wada K., Tamura T.A., Furuichi T., Mikoshiba K.J. Biol. Chem. 265:19786-19791(1990) Lubec G., Klug S.Submitted (MAR-2007) to UniProtKB Identification of Ser-55 as a major protein kinase A phosphorylation site on the 70-kDa subunit of neurofilaments. Early turnover during axonal transport.Sihag R.K., Nixon R.A.J. Biol. Chem. 266:18861-18867(1991) Genetics, evolution, and expression of the 68,000-mol-wt neurofilament protein isolation of a cloned cDNA probe.Lewis S.A., Cowan N.J.J. Cell Biol. 100:843-850(1985) RNA-binding protein is involved in aggregation of light neurofilament protein and is implicated in the pathogenesis of motor neuron degeneration.Lin H., Zhai J., Schlaepfer W.W.Hum. Mol. Genet. 14:3643-3659(2005) Comprehensive identification of phosphorylation sites in postsynaptic density preparations.Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.Mol. Cell. Proteomics 5:914-922(2006) O-linked N-acetylglucosamine proteomics of postsynaptic density preparations using lectin weak affinity chromatography and mass spectrometry.Vosseller K., Trinidad J.C., Chalkley R.J., Specht C.G., Thalhammer A., Lynn A.J., Snedecor J.O., Guan S., Medzihradszky K.F., Maltby D.A., Schoepfer R., Burlingame A.L.Mol. Cell. Proteomics 5:923-934(2006) Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain.Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.J. Proteome Res. 7:311-318(2008) Deficiency in ubiquitin ligase TRIM2 causes accumulation of neurofilament light chain and neurodegeneration.Balastik M., Ferraguti F., Pires-da Silva A., Lee T.H., Alvarez-Bolado G., Lu K.P., Gruss P.Proc. Natl. Acad. Sci. U.S.A. 105:12016-12021(2008)

39204499

NP_035040.1

NM_010910.1

P08551

63.38kD

ARMS-mediated Activation Pathway (1324638); Activation Of NMDA Receptor Upon Glutamate Binding And Postsynaptic Events Pathway (1323483); Amyotrophic Lateral Sclerosis (ALS) Pathway (83296); Amyotrophic Lateral Sclerosis (ALS) Pathway (511); Axon Guidance Pathway (1323598); CREB Phosphorylation Through The Activation Of CaMKII Pathway (1323490); CREB Phosphorylation Through The Activation Of Ras Pathway (1323486); Cytokine Signaling In Immune System Pathway (1323763); DAP12 Interactions Pathway (1323743); DAP12 Signaling Pathway (1323744)

NFL: one of the three (L, M, and H) intermediate filament proteins that form neurofilaments. Neurofilaments are involved in the maintenance of neuronal caliber. NF-L is the most abundant of the three neurofilament proteins. Defects cause Charcot-Marie-Tooth disease type 1F (CMT1F). Protein type: Cytoskeletal. Cellular Component: axon; cytoplasm; growth cone; intermediate filament; myelin sheath; neurofilament; neuron projection; TSC1-TSC2 complex. Molecular Function: identical protein binding; phospholipase binding; protein binding; protein binding, bridging; protein C-terminus binding; protein domain specific binding; protein heterodimerization activity; structural constituent of cytoskeleton; structural molecule activity. Biological Process: anterograde axon cargo transport; axon regeneration in the peripheral nervous system; axon transport of mitochondrion; intermediate filament bundle assembly; intermediate filament organization; intermediate filament polymerization and/or depolymerization; locomotion; microtubule cytoskeleton organization and biogenesis; negative regulation of neuron apoptosis; neurite morphogenesis; neurofilament bundle assembly; neurofilament cytoskeleton organization and biogenesis; neuromuscular process controlling balance; positive regulation of axonogenesis; protein polymerization; regulation of axon diameter; retrograde axon cargo transport

0.05 mg (Yeast)

190 USD

0.05 mg (E-Coli)

305

0.2 mg (Yeast)

460

0.2 mg (E-Coli)

580

0.5 mg (Yeast)

750