product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse B-lymphocyte antigen CD20
catalog :
MBS952945
quantity :
INQUIRE
price :
INQUIRE
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS952945
products type :
Recombinant Protein
products full name :
Recombinant Mouse B-lymphocyte antigen CD20
products short name :
B-lymphocyte antigen CD20
products name syn :
B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD20
other names :
B-lymphocyte antigen CD20; B-lymphocyte antigen CD20; B-lymphocyte antigen CD20; membrane-spanning 4-domains, subfamily A, member 1; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD_antigen: CD20
products gene name :
Ms4a1
other gene names :
Ms4a1; Ms4a1; Cd20; Ly-44; Ms4a2; AA960661; Cd20; Ly-44; Ms4a2
uniprot entry name :
CD20_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
111-291
sequence length :
291
sequence :
VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELI
QTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGIL
SAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAG
EKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEE
EEAEINFPAPPQEQESLPVENEIAP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
This protein may be involved in the regulation of B-cell activation and proliferation.
products references :
Cloning of a complementary DNA encoding a new mouse B lymphocyte differentiation antigen, homologous to the human B1 (CD20) antigen, and localization of the gene to chromosome 19.Tedder T.F., Klejman G., Disteche C.M., Adler D.A., Schlossman S.F., Saito H.J. Immunol. 141:4388-4394(1988) The oligomeric nature of the murine Fc epsilon RII/CD23. Implications for function.Dierks S.E., Bartlett W.C., Edmeades R.L., Gould H.J., Rao M., Conrad D.H.J. Immunol. 150:2372-2382(1993) CD20 deficiency in humans results in impaired T cell-independent antibody responses.Kuijpers T.W., Bende R.J., Baars P.A., Grummels A., Derks I.A.M., Dolman K.M., Beaumont T., Tedder T.F., van Noesel C.J.M., Eldering E., van Lier R.A.W.J. Clin. Invest. 120:214-222(2010)
ncbi gi num :
6671710
ncbi acc num :
NP_031667.1
ncbi gb acc num :
NM_007641.5
uniprot acc num :
P19437
ncbi mol weight :
22.3kD
ncbi pathways :
Hematopoietic Cell Lineage Pathway (83275); Hematopoietic Cell Lineage Pathway (489)
uniprot summary :
MS4A1: This protein may be involved in the regulation of B-cell activation and proliferation. Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5); also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. Belongs to the MS4A family. Protein type: Membrane protein, integral; Cell surface; Membrane protein, multi-pass. Cellular Component: external side of plasma membrane; extracellular space; integral to membrane; integral to plasma membrane; membrane; plasma membrane. Molecular Function: epidermal growth factor receptor binding; protein binding. Biological Process: B cell activation
size1 :
INQUIRE
price1 :
INQUIRE
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!