Recombinant Human Early growth response protein 1 | MyBioSource MBS952843 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Early growth response protein 1

catalog :

MBS952843

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS952843

products type :

Recombinant Protein

products full name :

Recombinant Human Early growth response protein 1

products short name :

Early growth response protein 1

products name syn :

AT225; Nerve growth factor-induced protein A; NGFI-A; Transcription factor ETR103; Transcription factor Zif268; Zinc finger protein 225; Zinc finger protein Krox-24

other names :

early growth response protein 1; Early growth response protein 1; early growth response protein 1; early growth response 1; AT225; Nerve growth factor-induced protein A; NGFI-A; Transcription factor ETR103; Transcription factor Zif268; Zinc finger protein 225; Zinc finger protein Krox-24

products gene name :

EGR1

other gene names :

EGR1; EGR1; TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268; KROX24; ZNF225; EGR-1; NGFI-A

uniprot entry name :

EGR1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

444-543

sequence length :

543

sequence :

SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTY
PSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNS
FSASTGLSDMTATFSPRTIEIC

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transcription

products description :

Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.

products references :

cDNA sequence of the human cellular early growth response gene Egr-1.Suggs S.V., Katzowitz J.L., Tsai-Morris C.-H., Sukhatme V.P.Nucleic Acids Res. 18:4283-4283(1990) A gene coding for a zinc finger protein is induced during 12-O-tetradecanoylphorbol-13-acetate-stimulated HL-60 cell differentiation.Shimizu N., Ohta M., Fujiwara C., Sagara J., Mochizuki N., Oda T., Utiyama H.J. Biochem. 111:272-277(1992) Expression of a zinc finger gene in HTLV-I- and HTLV-II-transformed cells.Wright J.J., Gunter K.C., Mitsuya H., Irving S.G., Kelly K., Siebenlist U.Science 248:588-591(1990) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Snail associates with EGR-1 and SP-1 to upregulate transcriptional activation of p15INK4b.Hu C.T., Chang T.Y., Cheng C.C., Liu C.S., Wu J.R., Li M.C., Wu W.S.FEBS J. 277:1202-1218(2010)

ncbi gi num :

4503493

ncbi acc num :

NP_001955.1

ncbi gb acc num :

NM_001964.2

uniprot acc num :

P18146

ncbi mol weight :

12.1kD

ncbi pathways :

AGE-RAGE Signaling Pathway In Diabetic Complications (1319988); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); BDNF Signaling Pathway (712093); Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway (137993); Cytokine Signaling In Immune System Pathway (1269310); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); ErbB1 Downstream Signaling Pathway (138057); Glucocorticoid Receptor Regulatory Network Pathway (138014); HTLV-I Infection Pathway (373901); HTLV-I Infection Pathway (373889)

ncbi summary :

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene. [provided by RefSeq, Dec 2014]

uniprot summary :

EGR1: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation. By growth factors. Belongs to the EGR C2H2-type zinc-finger protein family. Protein type: DNA-binding; Transcription factor; C2H2-type zinc finger protein. Chromosomal Location of Human Ortholog: 5q31.1. Cellular Component: cytoplasm; nucleoplasm; nucleus. Molecular Function: DNA binding; histone acetyltransferase binding; metal ion binding; protein binding; sequence-specific DNA binding; transcription factor activity. Biological Process: BMP signaling pathway; cytokine and chemokine mediated signaling pathway; negative regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of apoptosis; regulation of protein sumoylation; response to glucose stimulus; response to insulin stimulus; T cell differentiation; transcription from RNA polymerase II promoter

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1335

more info or order :

MyBioSource product webpage