product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Interferon alpha/beta receptor 2
catalog :
MBS952760
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS952760
products type :
Recombinant Protein
products full name :
Recombinant Human Interferon alpha/beta receptor 2
products short name :
Interferon alpha/beta receptor 2
products name syn :
Interferon alpha binding protein; Type I interferon receptor 2
other names :
interferon alpha/beta receptor 2 isoform b; Interferon alpha/beta receptor 2; interferon alpha/beta receptor 2; interferon alpha and beta receptor subunit 2; Interferon alpha binding protein; Type I interferon receptor 2
products gene name :
IFNAR2
other gene names :
IFNAR2; IFNAR2; IFN-R; IFNABR; IFNARB; IFN-alpha-REC; IFNABR; IFNARB; IFN-R-2; IFN-alpha binding protein; IFN-alpha/beta receptor 2
uniprot entry name :
INAR2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
27-243
sequence length :
239
sequence :
ISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTH
YTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHE
AYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVG
FTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHK
PEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVI
KSPLKCTLLPPGQESESAESAK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Epigenetics and Nuclear Signaling
products description :
Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity.
products references :
The human interferon alpha/beta receptor characterization and molecular cloning.Novick D., Cohen B., Rubinstein M.Cell 77:391-400(1994)
ncbi gi num :
19923129
ncbi acc num :
NP_000865.2
ncbi gb acc num :
NM_000874.4
uniprot acc num :
P48551
ncbi mol weight :
40.74kD
ncbi pathways :
Cytokine Signaling In Immune System Pathway (1269310); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); Hepatitis C Pathway (173973); Hepatitis C Pathway (173907); Herpes Simplex Infection Pathway (377873); Herpes Simplex Infection Pathway (377865); Immune System Pathway (1269170); Influenza A Pathway (217173)
ncbi summary :
The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. Multiple transcript variants encoding at least two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
IFNAR2: Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity. Belongs to the type II cytokine receptor family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Receptor, cytokine; Membrane protein, integral. Chromosomal Location of Human Ortholog: 21q22.11. Cellular Component: extracellular region; extracellular space; integral to plasma membrane; intracellular; plasma membrane. Molecular Function: interferon-alpha/beta binding; interferon-alpha/beta receptor activity; interleukin-20 binding; protein binding; protein kinase binding. Biological Process: cell proliferation; cell surface receptor linked signal transduction; cytokine and chemokine mediated signaling pathway; JAK-STAT cascade; regulation of transcription from RNA polymerase II promoter; response to virus. Disease: Hepatitis B Virus, Susceptibility To
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
970
size5 :
1 mg (E-Coli)
price5 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!