Recombinant Human Calcium-dependent phospholipase A2 | MyBioSource MBS952738 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Calcium-dependent phospholipase A2

catalog :

MBS952738

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS952738

products type :

Recombinant Protein

products full name :

Recombinant Human Calcium-dependent phospholipase A2

products short name :

Calcium-dependent phospholipase A2

other names :

Calcium-dependent phospholipase A2; calcium-dependent phospholipase A2; phospholipase A2 group V; Group V phospholipase A2; PLA2-10; Phosphatidylcholine 2-acylhydrolase 5

products gene name :

PLA2G5

other gene names :

PLA2G5; PLA2G5; FRFB; GV-PLA2; PLA2-10; hVPLA(2)

uniprot entry name :

PA2G5_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

21-138

sequence length :

138

sequence :

GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDG
TDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCE
PGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
S

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cardiovascular

ncbi acc num :

NP_000920.1

uniprot acc num :

P39877

ncbi mol weight :

15.59kD

ncbi pathways :

Acyl Chain Remodelling Of PC Pathway (1270062); Acyl Chain Remodelling Of PE Pathway (1270058); Acyl Chain Remodelling Of PG Pathway (1270069); Acyl Chain Remodelling Of PI Pathway (1270067); Acyl Chain Remodelling Of PS Pathway (1270065); Arachidonic Acid Metabolism Pathway (82991); Arachidonic Acid Metabolism Pathway (366); Ether Lipid Metabolism Pathway (82990); Ether Lipid Metabolism Pathway (365); Fat Digestion And Absorption Pathway (194385)

ncbi summary :

This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholipids and free fatty acids including arachidonic acid. It preferentially hydrolyzes linoleoyl-containing phosphatidylcholine substrates. Secretion of this enzyme is thought to induce inflammatory responses in neighboring cells. Alternatively spliced transcript variants have been found, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

uniprot summary :

PLA2G5: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L- alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L- alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle. Defects in PLA2G5 are the cause of fleck retina, familial benign (FRFB). An autosomal recessive condition associated with a distinctive retinal appearance and no apparent visual or electrophysiologic deficits. Affected individuals are asymptomatic, but fundus examination reveals a striking pattern of diffuse, yellow-white, fleck-like lesions extending to the far periphery of the retina but sparing the foveal region. Belongs to the phospholipase A2 family. Protein type: Lipid Metabolism - arachidonic acid; EC 3.1.1.4; Secreted, signal peptide; Lipid Metabolism - linoleic acid; Phospholipase; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - ether lipid; Cell surface; Lipid Metabolism - glycerophospholipid; Secreted. Chromosomal Location of Human Ortholog: 1p36-p34. Cellular Component: cell surface; extracellular region; Golgi apparatus; perinuclear region of cytoplasm; plasma membrane. Molecular Function: calcium ion binding; calcium-dependent phospholipase A2 activity; heparin binding. Biological Process: arachidonic acid secretion; glycerophospholipid biosynthetic process; leukotriene biosynthetic process; lipid catabolic process; phosphatidic acid biosynthetic process; phospholipid metabolic process; platelet activating factor biosynthetic process; response to cAMP; response to cytokine stimulus. Disease: Fleck Retina, Familial Benign

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

855

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1080

more info or order :

MyBioSource product webpage