catalog number :
MBS952737
products type :
Recombinant Protein
products full name :
Recombinant Mouse Cytochrome P450 2E1
products short name :
Cytochrome P450 2E1
other names :
cytochrome P450 2E1; Cytochrome P450 2E1; cytochrome P450 2E1; cytochrome P450, family 2, subfamily e, polypeptide 1; 4-nitrophenol 2-hydroxylase (EC:1.14.13.n7); CYPIIE1; Cytochrome P450-ALC; Cytochrome P450-J
products gene name :
Cyp2e1
other gene names :
Cyp2e1; Cyp2e1; Cyp2e; Cyp2e; Cyp2e-1
uniprot entry name :
CP2E1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-493
sequence :
AVLGITVALLVWIATLLLVSIWKQIYRSWNLPPGPFPIP
FFGNIFQLDLKDIPKSLTKLAKRFGPVFTLHLGQRRIVV
LHGYKAVKEVLLNHKNEFSGRGDIPVFQEYKNKGIIFNN
GPTWKDVRRFSLSILRDWGMGKQGNEARIQREAHFLVEE
LKKTKGQPFDPTFLIGCAPCNVIADILFNKRFDYDDKKC
LELMSLFNENFYLLSTPWIQAYNYFSDYLQYLPGSHRKV
MKNVSEIRQYTLGKAKEHLKS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
ncbi acc num :
NP_067257.1
ncbi gb acc num :
NM_021282.2
ncbi mol weight :
58.67kD
ncbi pathways :
Arachidonic Acid Metabolism Pathway (83190); Arachidonic Acid Metabolism Pathway (366); Biological Oxidations Pathway (1324455); CYP2E1 Reactions Pathway (1324462); Chemical Carcinogenesis Pathway (673229); Chemical Carcinogenesis Pathway (673237); Cytochrome P450 Pathway (198390); Cytochrome P450 - Arranged By Substrate Type Pathway (1324457); Drug Metabolism - Cytochrome P450 Pathway (83229); Drug Metabolism - Cytochrome P450 Pathway (427)
uniprot summary :
CYP2E1: Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites. Inactivates a number of drugs and xenobiotics and also bioactivates many xenobiotic substrates to their hepatotoxic or carcinogenic forms. Belongs to the cytochrome P450 family. Protein type: Oxidoreductase; Xenobiotic Metabolism - metabolism by cytochrome P450; Endoplasmic reticulum; Lipid Metabolism - linoleic acid; Lipid Metabolism - arachidonic acid; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 1.14.13.n7. Cellular Component: endoplasmic reticulum; Golgi membrane; intracellular membrane-bound organelle; intrinsic to endoplasmic reticulum membrane; membrane; mitochondrion. Molecular Function: 1-hydroxy-2-naphthoate hydroxylase activity; 1-hydroxy-2-oxolimonene 1,2-monooxygenase activity; 2-hydroxy-phenylacetate hydroxylase activity; 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; 2-oxo-delta3-4,5,5-trimethylcyclopentenylacetyl-CoA 1,2-monooxygenase activity; 3,5-xylenol methylhydroxylase activity; 3-(3-hydroxy-phenyl)propionate hydroxylase activity; 3-methyl-2-oxo-1,2-dihydroquinoline 6-monooxygenase activity; 4-chlorobenzaldehyde oxidase activity; 4-hydroxyphenylacetate 3-monooxygenase activity; 4-nitrophenol 4-monooxygenase activity; 6-hydroxy-3-methyl-2-oxo-1,2-dihydroquinoline 6-monooxygenase activity; 6-hydroxynicotinate 3-monooxygenase activity; alpha-pinene monooxygenase [NADH] activity; arachidonic acid epoxygenase activity; carbon disulfide oxygenase activity; chlorophenol 4-monooxygenase activity; dibenzothiophene monooxygenase activity; dimethyl sulfide monooxygenase activity; enzyme binding; heme binding; iron ion binding; limonene monooxygenase activity; metal ion binding; monooxygenase activity; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; phenanthrene 1,2-monooxygenase activity; phenanthrene 3,4-monooxygenase activity; phenanthrene 9,10-monooxygenase activity; phenylacetate hydroxylase activity; steroid hydroxylase activity; styrene monooxygenase activity; tetrahydrofuran hydroxylase activity; toluene 2-monooxygenase activity; toluene 3-monooxygenase activity; toluene 4-monooxygenase activity; toluene-4-sulfonate monooxygenase activity; toluene-sulfonate methyl-monooxygenase activity; xylene monooxygenase activity. Biological Process: drug metabolic process; epoxygenase P450 pathway; heterocycle metabolic process; monoterpenoid metabolic process; steroid metabolic process; triacylglycerol metabolic process; xenobiotic metabolic process
size5 :
0.05 mg (Baculovirus)