product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interferon gamma (IFNG)
catalog :
MBS952582
quantity :
1 mg (E-Coli)
price :
1240 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS952582
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interferon gamma (IFNG)
products short name :
(Rhesus macaque) Interferon gamma (IFNG)
products name syn :
Recombinant (Rhesus macaque) Interferon gamma (IFNG); Interferon gamma; IFN-gamma
other names :
interferon gamma; Interferon gamma; interferon gamma; interferon-gamma
products gene name syn :
IFNG
other gene names :
IFNG; IFNG; IFN-gamma; IFN-gamma
uniprot entry name :
IFNG_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
24-165
sequence length :
165
sequence :
QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEE
SDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDIN
VKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVM
AELSPAAKIGKRKRSQMFRGRRASQ
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
74136365
ncbi acc num :
NP_001028077.1
ncbi gb acc num :
NM_001032905.1
uniprot acc num :
P63310
ncbi mol weight :
19,332 Da
ncbi pathways :
African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Amoebiasis Pathway (167336); Amoebiasis Pathway (167191); Antigen Processing And Presentation Pathway (86744); Antigen Processing And Presentation Pathway (485); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795)
uniprot summary :
Function: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Subunit structure: Homodimer. Subcellular location: Secreted. Tissue specificity: Released primarily from activated T lymphocytes. Sequence similarities: Belongs to the type II (or gamma) interferon family.
size1 :
1 mg (E-Coli)
price1 :
1240 USD
size2 :
1 mg (Yeast)
price2 :
1700
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!