product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Elafin
catalog :
MBS952480
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS952480
products type :
Recombinant Protein
products full name :
Recombinant Human Elafin
products short name :
Elafin
products name syn :
Elastase-specific inhibitor; ESI; Peptidase inhibitor 3; PI-3; Protease inhibitor WAP3; Skin-derived antileukoproteinase; SKALPWAP four-disulfide core domain protein 14
other names :
elafin preproprotein; Elafin; elafin; peptidase inhibitor 3; Elastase-specific inhibitor; ESI; Peptidase inhibitor 3; PI-3; Protease inhibitor WAP3; Skin-derived antileukoproteinase; SKALP; WAP four-disulfide core domain protein 14
products gene name :
PI3
other gene names :
PI3; PI3; ESI; WAP3; SKALP; WFDC14; cementoin; WAP3; WFDC14; ESI; PI-3; SKALP
uniprot entry name :
ELAF_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
61-117
sequence length :
117
sequence :
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCP
GIKKCCEGSCGMACFVPQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Signal Transduction
products description :
Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
products references :
Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment.Saheki T., Ito F., Hagiwara H., Saito Y., Kuroki J., Tachibana S., Hirose S.Biochem. Biophys. Res. Commun. 185:240-245(1992)
ncbi gi num :
4505787
ncbi acc num :
NP_002629.1
ncbi gb acc num :
NM_002638.3
uniprot acc num :
P19957
ncbi mol weight :
22.01kD
ncbi summary :
This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]
uniprot summary :
elafin: Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Protein type: Secreted; Extracellular matrix; Inhibitor; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 20q13.12. Cellular Component: proteinaceous extracellular matrix. Molecular Function: endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity. Biological Process: copulation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!