product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Desmoglein-3
catalog :
MBS952333
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
product information
catalog number :
MBS952333
products type :
Recombinant Protein
products full name :
Recombinant Human Desmoglein-3
products short name :
Desmoglein-3
products name syn :
130 kDa pemphigus vulgaris antigen; PVA; Cadherin family member 6
other names :
desmoglein-3 preproprotein; Desmoglein-3; desmoglein-3; desmoglein 3; 130 kDa pemphigus vulgaris antigen; PVA; Cadherin family member 6
products gene name :
DSG3
other gene names :
DSG3; DSG3; PVA; CDHF6; CDHF6; PVA
uniprot entry name :
DSG3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
50-615; Provide the complete extracellular domain.
sequence length :
615
sequence :
EWVKFAKPCREGEDNSKRNPIAKITSDYQATQKITYRIS
GVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITC
RALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEI
EENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAG
TPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDG
EGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSS
ELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDP
RTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVIS
RYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKK
LVDYILGTYQAIDEDTNKAASNVKYVMGRNDGGYLMIDS
KTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTST
GTVYVRVPDFNDNCPTAVLEKDAVCSSSPSVVVSARTLN
NRYTGPYTFALEDQPVKLPAVWSITTLNATSALLRAQEQ
IPPGVYHISLVLTDSQNNRCEMPRSLTLEVCQCDNRGIC
GTSYPTTSPGTRYGRPHSGR
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cell Adhesion
products description :
Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
products references :
Autoantibodies against a novel epithelial cadherin in pemphigus vulgaris, a disease of cell adhesion.Amagai M., Klaus-Kovtun V., Stanley J.R.Cell 67:869-877(1991) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) DNA sequence and analysis of human chromosome 18.Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J., Cook A., DeCaprio D., Engels R., Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T., Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E., Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H., O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K., Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R., Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.Nature 437:551-555(2005) Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.J. Proteome Res. 5:1493-1503(2006) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
ncbi gi num :
119964718
ncbi acc num :
NP_001935.2
ncbi gb acc num :
NM_001944.2
uniprot acc num :
P32926
ncbi mol weight :
78.9kD
ncbi pathways :
Apoptosis Pathway (1270262); Apoptotic Cleavage Of Cell Adhesion Proteins Pathway (1270290); Apoptotic Cleavage Of Cellular Proteins Pathway (1270288); Apoptotic Execution Phase Pathway (1270287); Programmed Cell Death Pathway (1270261)
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!