Recombinant Mouse Glutathione S-transferase P 1 | MyBioSource MBS952294 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Glutathione S-transferase P 1

catalog :

MBS952294

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS952294

products type :

Recombinant Protein

products full name :

Recombinant Mouse Glutathione S-transferase P 1

products short name :

Glutathione S-transferase P 1

products name syn :

GST YF-YFGST class-pi; GST-piB; Preadipocyte growth factor

other names :

glutathione S-transferase P 1; Glutathione S-transferase P 1; glutathione S-transferase P 1; glutathione S-transferase, pi 1; GST YF-YF; GST class-pi; GST-piB; Preadipocyte growth factor

products gene name :

Gstp1

other gene names :

Gstp1; Gstp1; GstpiB; Gstpib; Gst P1

uniprot entry name :

GSTP1_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-210

sequence length :

210

sequence :

PPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWM
QGLLKPTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGL
YGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKND
YVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLL
DLLLIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSS
PEHVNRPINGNGKQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Can metabolize 1-chloro-2,4-dinitrobenzene. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.

products references :

A cDNA sequence coding a class pi glutathione S-transferase of mouse.Hatayama I., Satoh K., Sato K.Nucleic Acids Res. 18:4606-4606(1990) Isolation and characterization of two mouse PI class glutathione S-transferase genes.Bammler T.K., Smith C.A.D., Wolf R.C.Biochem. J. 298:385-390(1994) Two murine GSTpi genes are arranged in tandem and are differentially expressed.Xu X., Stambrook P.J.J. Biol. Chem. 269:30268-30273(1994) Molecular cloning of mouse preadipocyte growth factor.Kawada T., Aoki N., Kamei Y., Sugimoto E. Lubec G., Klug S., Kang S.U.Submitted (APR-2007) to UniProtKB Purification, mass spectrometric characterization, and covalent modification of murine glutathione S-transferases.Mitchell A.E., Morin D., Lame M.W., Jones A.D.Chem. Res. Toxicol. 8:1054-1062(1995) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) Molecular structure at 1.8 A of mouse liver class pi glutathione S-transferase complexed with S-(p-nitrobenzyl) glutathione and other inhibitors.Garcia-Saez I., Parraga A., Phillips M.F., Mantle T.J., Coll M.J. Mol. Biol. 237:298-314(1994) The three-dimensional structure of Cys-47-modified mouse liver glutathione S-transferase P1-1. Carboxymethylation dramatically decreases the affinity for glutathione and is associated with a loss of electron density in the alphaB-310B region.Vega M.C., Walsh S.B., Mantle T.J., Coll M.J. Biol. Chem. 273:2844-2850(1998)

ncbi gi num :

10092608

ncbi acc num :

NP_038569.1

ncbi gb acc num :

NM_013541.1

uniprot acc num :

P19157

ncbi mol weight :

39.5kD

ncbi pathways :

Biological Oxidations Pathway (1324455); Cellular Responses To Stress Pathway (1324506); Chemical Carcinogenesis Pathway (673229); Chemical Carcinogenesis Pathway (673237); Detoxification Of Reactive Oxygen Species Pathway (1324512); Diurnally Regulated Genes With Circadian Orthologs Pathway (198406); Drug Metabolism - Cytochrome P450 Pathway (83229); Drug Metabolism - Cytochrome P450 Pathway (427); Glutathione Conjugation Pathway (1324479); Glutathione Metabolism Pathway (83172)

uniprot summary :

GSTP1: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Homodimer. Interacts with CDK5. Belongs to the GST superfamily. Pi family. Protein type: Transferase; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 2.5.1.18; Other Amino Acids Metabolism - glutathione. Cellular Component: cytoplasm; cytosol; extracellular space; intracellular; mitochondrion; nucleus; plasma membrane; protein complex; vesicle. Molecular Function: drug binding; glutathione binding; glutathione transferase activity; JUN kinase binding; kinase regulator activity; protein binding; protein kinase binding; transferase activity. Biological Process: glutathione metabolic process; metabolic process; negative regulation of acute inflammatory response; negative regulation of apoptosis; negative regulation of biosynthetic process; negative regulation of fibroblast proliferation; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of interleukin-1 beta production; negative regulation of JNK activity; negative regulation of nitric-oxide synthase biosynthetic process; negative regulation of stress-activated MAPK cascade; negative regulation of tumor necrosis factor production; positive regulation of superoxide release; regulation of stress-activated MAPK cascade; response to reactive oxygen species

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage