protein

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain

MBS952228

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain

H-2 class II histocompatibility antigen gamma chain

Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74

H-2 class II histocompatibility antigen gamma chain isoform 1; H-2 class II histocompatibility antigen gamma chain; H-2 class II histocompatibility antigen gamma chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD_antigen: CD74

Cd74

Cd74; Cd74; Ii; CLIP; DHLAG; HLADG; Ia-GAMMA; Ii; Ii

HG2A_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

56-279

215

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMAT
PLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSG
PLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLL
FEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAF
RPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRG
RHNCSEPLDMEDLSSGLGVTRQELGQVTL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Primary structure of the gene for the murine Ia antigen-associated invariant chains (Ii) . An alternatively spliced exon encodes a cysteine-rich domain highly homologous to a repetitive sequence of thyroglobulin.Koch N., Lauer W., Habicht J., Dobberstein B.EMBO J. 6:1677-1683(1987) Complete sequence of the murine invariant chain (Ii) gene.Zhu L., Jones P.P.Nucleic Acids Res. 17:447-448(1989) Nucleotide sequences of the murine Ia-associated invariant chain (Ii) and I-E (H-2S, Beta) chain expressible cDNA clones.Stone J., Perry R., Todd J.A., McDevitt H.O. The IFN-gamma response of the murine invariant chain gene is mediated by a complex enhancer that includes several MHC class II consensus elements.Eades A.-M., Litfin M., Rahmsdorf H.J.J. Immunol. 144:4399-4409(1990) Structure of the murine Ia-associated invariant (Ii) chain as deduced from a cDNA clone.Singer P.A., Lauer W., Dembic Z., Mayer W.E., Lipp J., Koch N., Hammerling G., Klein J., Dobberstein B.EMBO J. 3:873-877(1984) Identification of the glycosaminoglycan-attachment site of mouse invariant-chain proteoglycan core protein by site-directed mutagenesis.Miller J., Hatch J.A., Simonis S., Cullen S.E.Proc. Natl. Acad. Sci. U.S.A. 85:1359-1363(1988) The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)

110624770

NP_001036070.1

NM_001042605.1

P04441

29.5kD

Adaptive Immune System Pathway (1323640); Antigen Processing And Presentation Pathway (83271); Antigen Processing And Presentation Pathway (485); Cell Surface Interactions At The Vascular Wall Pathway (1323592); Hemostasis Pathway (1323559); Herpes Simplex Infection Pathway (377874); Herpes Simplex Infection Pathway (377865); Immune System Pathway (1323639); MHC Class II Antigen Presentation Pathway (1323668); Macrophage Markers Pathway (672439)

CD74: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74- ROS1 chimeric protein. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Endoplasmic reticulum; Receptor, cytokine. Cellular Component: cell surface; endoplasmic reticulum; external side of plasma membrane; Golgi apparatus; integral to membrane; integral to plasma membrane; late endosome; lysosome; membrane; MHC class II protein complex; multivesicular body; plasma membrane; vacuole. Molecular Function: beta-amyloid binding; cytokine binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; MHC class II protein binding; MHC class II protein binding, via antigen binding groove; nitric-oxide synthase binding; protein binding. Biological Process: activation of MAPK activity; adaptive immune response; antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class II; cell proliferation; chaperone cofactor-dependent protein folding; defense response; immune response; immune system process; immunoglobulin mediated immune response; intracellular protein transport; negative regulation of apoptosis; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of peptide secretion; negative regulation of T cell differentiation; negative thymic T cell selection; positive regulation of adaptive immune response; positive regulation of B cell proliferation; positive regulation of cytokine and chemokine mediated signaling pathway; positive regulation of dendritic cell antigen processing and presentation; positive regulation of fibroblast proliferation; positive regulation of innate immune response; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell differentiation; positive regulation of T-helper 2 type immune response; positive thymic T cell selection; prostaglandin biosynthetic process; protein complex assembly; signal transduction

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

975

1 mg (E-Coli)

1180