product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Melanocyte protein PMEL
catalog :
MBS952140
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS952140
products type :
Recombinant Protein
products full name :
Recombinant Human Melanocyte protein PMEL
products short name :
Melanocyte protein PMEL
products name syn :
ME20-M; ME20M; Melanocyte protein Pmel 17; Melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; P1; P100; Premelanosome protein; Silver locus protein homolog
other names :
melanocyte protein PMEL isoform 2; Melanocyte protein PMEL; melanocyte protein PMEL; premelanosome protein; ME20-M; ME20M
products gene name :
PMEL
other gene names :
PMEL; PMEL; P1; SI; SIL; ME20; P100; SILV; ME20M; gp100; ME20-M; PMEL17; D12S53E; D12S53E; PMEL17; SILV; ME20M; ME20-S; ME20S
uniprot entry name :
PMEL_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-467
sequence length :
626
sequence :
KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRG
GQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQV
IWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSG
SWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLG
THTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSV
SQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSY
TWDFGDSSGTLISRALVVTHT
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Metabolism
products description :
Plays a central role in the biogenesis of melanosomes. Involved in the maturation of melanosomes from stage I to II. The transition from stage I melanosomes to stage II melanosomes involves an elongation of the vesicle, and the appearance within of distinct fibrillar structures. Release of the soluble form, ME20-S, could protect tumor cells from antibody mediated immunity.
products references :
A melanocyte-specific gene, Pmel 17, maps near the silver coat color locus on mouse chromosome 10 and is in a syntenic region on human chromosome 12.Kwon B.S., Chintamaneni C., Kozak C.A., Copeland N.G., Gilbert D.J., Jenkins N.A., Barton D., Francke U., Kobayashi Y., Kim K.-K.Proc. Natl. Acad. Sci. U.S.A. 88:9228-9232(1991)
ncbi gi num :
318037593
ncbi acc num :
NP_001186982.1
ncbi gb acc num :
NM_001200053.1
uniprot acc num :
P40967
ncbi mol weight :
63kD
ncbi summary :
This gene encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2011]
uniprot summary :
SILV: Plays a central role in the biogenesis of melanosomes. Involved in the maturation of melanosomes from stage I to II. The transition from stage I melanosomes to stage II melanosomes involves an elongation of the vesicle, and the appearance within of distinct fibrillar structures. Release of the soluble form, ME20-S, could protect tumor cells from antibody mediated immunity. Belongs to the PMEL/NMB family. 5 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Vesicle. Chromosomal Location of Human Ortholog: 12q13-q14. Cellular Component: endoplasmic reticulum membrane; extracellular region; Golgi apparatus; integral to membrane; melanosome; plasma membrane. Molecular Function: protein binding. Biological Process: melanin biosynthetic process; melanosome organization and biogenesis
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.05 mg (Yeast)
price2 :
185
size3 :
0.2 mg (E-Coli)
price3 :
420
size4 :
0.2 mg (Yeast)
price4 :
420
size5 :
0.5 mg (E-Coli)
price5 :
680
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!