Recombinant Mouse Hyaluronan synthase 2 | MyBioSource MBS952102 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Hyaluronan synthase 2

catalog :

MBS952102

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS952102

products type :

Recombinant Protein

products full name :

Recombinant Mouse Hyaluronan synthase 2

products short name :

Hyaluronan synthase 2

products name syn :

Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2

other names :

Hyaluronan synthase 2; hyaluronan synthase 2; hyaluronan synthase 2; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2

products gene name :

Has2

other gene names :

Has2; Has2; HA synthase 2

uniprot entry name :

HYAS2_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

67-374

sequence length :

552

sequence :

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQS
VKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSA
TYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICI
MQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASS
VEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYW
MAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY
NQEFMGNQCSFGDDRHLTNRV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix.

products references :

Molecular cloning and characterization of a putative mouse hyaluronan synthase.Spicer A.P., Augustine M.L., McDonald J.A.J. Biol. Chem. 271:23400-23406(1996) Spicer A.P., Augustine M.L., McDonald J.A.Coding sequence of a hyaluronan synthase homologue expressed during expansion of the mouse cumulus-oocyte complex.Fueloep C., Salustri A., Hascall V.C.Arch. Biochem. Biophys. 337:261-266(1997) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Homologs of the Xenopus developmental gene DG42 are present in zebrafish and mouse and are involved in the synthesis of Nod-like chitin oligosaccharides during early embryogenesis.Semino C.E., Specht C.A., Raimondi A., Robbins P.W.Proc. Natl. Acad. Sci. U.S.A. 93:4548-4553(1996) Three isoforms of mammalian hyaluronan synthases have distinct enzymatic properties.Itano N., Sawai T., Yoshida M., Lenas P., Yamada Y., Imagawa M., Shinomura T., Hamaguchi M., Yoshida Y., Ohnuki Y., Miyauchi S., Spicer A.P., McDonald J.A., Kimata K.J. Biol. Chem. 274:25085-25092(1999) Disruption of hyaluronan synthase-2 abrogates normal cardiac morphogenesis and hyaluronan-mediated transformation of epithelium to mesenchyme.Camenisch T.D., Spicer A.P., Brehm-Gibson T., Biesterfeldt J., Augustine M.L., Calabro A. Jr., Kubalak S., Klewer S.E., McDonald J.A.J. Clin. Invest. 106:349-360(2000)

ncbi acc num :

NP_032242.3

uniprot acc num :

P70312

ncbi mol weight :

40kD

uniprot summary :

HAS2: Plays a role in hyaluronan/hyaluronic acid (HA) synthesis. Expressed in fibroblasts. Belongs to the nodC/HAS family. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis; EC 2.4.1.212; Transferase. Cellular Component: cytoplasm; integral to membrane; integral to plasma membrane; membrane. Molecular Function: hyaluronan synthase activity; transferase activity; transferase activity, transferring glycosyl groups. Biological Process: cell adhesion; extracellular polysaccharide biosynthetic process; hyaluronan biosynthetic process; hyaluronan metabolic process; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of keratinocyte migration; positive regulation of smooth muscle cell migration; vasculogenesis

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage