protein

Recombinant Mouse Protein S100-A8

MBS952076

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse Protein S100-A8

S100-A8

Calgranulin-A; Chemotactic cytokine CP-10; Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8; MRP-8; p8; Pro-inflammatory S100 cytokine; S100 calcium-binding protein A8

protein S100-A8; Protein S100-A8; protein S100-A8; S100 calcium binding protein A8 (calgranulin A); Calgranulin-A; Chemotactic cytokine CP-10; Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8; MRP-8; p8; Pro-inflammatory S100 cytokine; S100 calcium-binding protein A8

S100a8

S100a8; S100a8; p8; B8Ag; CFAg; Caga; MRP8; CP-10; 60B8Ag; AI323541; Caga; Mrp8; MRP-8; p8

S10A8_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

Feb-89

89

PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTT
ECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVG
VASHKDSHKE

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 ses to contribute to S-nitrosylation site selectivity.

Mouse MRP8 and MRP14, two intracellular calcium-binding proteins associated with the development of the myeloid lineage.Lagasse E., Weissman I.L.Blood 79:1907-1915(1992) Identification of a chemotactic domain of the pro-inflammatory S100 protein CP-10.Lackmann M., Rajasekariah P., Iismaa S.E., Jones G., Cornish C.J., Hu S., Simpson R.J., Moritz R.L., Geczy C.L.J. Immunol. 150:2981-2991(1993) Molecular characterisation of the genomic locus of the mouse MRP8 gene.Nacken W.K.F., Manitz M.P., Sorg C.Biochim. Biophys. Acta 1315:1-5(1996) Purification and structural analysis of a murine chemotactic cytokine (CP-10) with sequence homology to S100 proteins.Lackmann M., Cornish C.J., Simpson R.J., Moritz R.L., Geczy C.L.J. Biol. Chem. 267:7499-7504(1992) A null mutation in the inflammation-associated S100 protein S100A8 causes early resorption of the mouse embryo.Passey R.J., Williams E., Lichanska A.M., Wells C., Hu S., Geczy C.L., Little M.H., Hume D.A.J. Immunol. 163:2209-2216(1999) Mrp8 and Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal, endotoxin-induced shock.Vogl T., Tenbrock K., Ludwig S., Leukert N., Ehrhardt C., van Zoelen M.A.D., Nacken W., Foell D., van der Poll T., Sorg C., Roth J.Nat. Med. 13:1042-1049(2007) S100A8 and S100A9 mediate endotoxin-induced cardiomyocyte dysfunction via the receptor for advanced glycation end products.Boyd J.H., Kan B., Roberts H., Wang Y., Walley K.R.Circ. Res. 102:1239-1246(2008) S-nitrosylated S100A8 novel anti-inflammatory properties.Lim S.Y., Raftery M., Cai H., Hsu K., Yan W.X., Hseih H.L., Watts R.N., Richardson D., Thomas S., Perry M., Geczy C.L.J. Immunol. 181:5627-5636(2008) Anti-infective protective properties of S100 calgranulins.Hsu K., Champaiboon C., Guenther B.D., Sorenson B.S., Khammanivong A., Ross K.F., Geczy C.L., Herzberg M.C.Antiinflamm. Antiallergy Agents Med. Chem. 8:290-305(2009) Inflammation-associated S100 proteins new mechanisms that regulate function.Goyette J., Geczy C.L.Amino Acids 41:821-842(2011)

7305453

NP_038678.1

NM_013650.2

P27005

26.16kD

S100A8: S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH- oxidase by facilitating the enzyme complex assembly at the cell membrane, transfering arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF- kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread. Belongs to the S-100 family. Cellular Component: cytoplasm; cytoskeleton; extracellular region; extracellular space; membrane; nucleus; plasma membrane. Molecular Function: antioxidant activity; arachidonic acid binding; calcium ion binding; metal ion binding; microtubule binding; RAGE receptor binding; zinc ion binding. Biological Process: apoptosis; astrocyte development; autophagy; caspase activation; chemotaxis; immune system process; inflammatory response; innate immune response; leukocyte migration during inflammatory response; neutrophil chemotaxis; peptidyl-cysteine S-nitrosylation; positive regulation of inflammatory response; positive regulation of peptide secretion; regulation of inflammatory response

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750