catalog number :
MBS952031
products type :
Recombinant Protein
products full name :
Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2)
products short name :
Cytochrome P450 11B2, mitochondrial (CYP11B2)
products name syn :
Cytochrome P450 11B2, mitochondrial; Aldosterone synthase; ALDOS; EC=1.14.15.4; EC=1.14.15.5; Aldosterone-synthesizing enzyme; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Steroid 18-hydroxylase
other names :
cytochrome P450 11B2, mitochondrial; Cytochrome P450 11B2, mitochondrial; cytochrome P450 11B2, mitochondrial; cytochrome P-450C18; aldosterone synthase; cytochrome P-450Aldo; steroid 11-beta-monooxygenase; steroid 11-beta/18-hydroxylase; aldosterone-synthesizing enzyme; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2; cytochrome P450, family 11, subfamily B, polypeptide 2; Aldosterone synthase (EC:1.14.15.4, EC:1.14.15.5); ALDOS; Aldosterone-synthesizing enzyme; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Steroid 18-hydroxylase
products gene name :
CYP11B2
other gene names :
CYP11B2; CYP11B2; CPN2; ALDOS; CYP11B; CYP11BL; CYPXIB2; P450C18; P-450C18; P450aldo; ALDOS
uniprot entry name :
C11B2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-503, Mature full length protein.
sequence :
GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEH
LHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQ
VDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNR
LRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSA
SLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFE
AWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKA
ELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDV
QQILRQESLAAAASISEHPQKATTELPLLRAALKETLRL
YPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNA
ALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGR
RLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPG
TSPLLTFRAIN
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
ncbi acc num :
NP_000489.3
ncbi gb acc num :
NM_000498.3
ncbi mol weight :
57,560 Da
ncbi pathways :
ACE Inhibitor Pathway (198763); Biological Oxidations Pathway (105698); C21-Steroid Hormone Biosynthesis, Progesterone = Corticosterone/aldosterone Pathway (413394); C21-Steroid Hormone Biosynthesis, Progesterone = Corticosterone/aldosterone Pathway (468295); C21-Steroid Hormone Biosynthesis, Progesterone = Cortisol/cortisone Pathway (413395); C21-Steroid Hormone Biosynthesis, Progesterone = Cortisol/cortisone Pathway (468370); Cytochrome P450 - Arranged By Substrate Type Pathway (105700); Endogenous Sterols Pathway (105701); Glucocorticoid Mineralcorticoid Metabolism Pathway (198902); Glucocorticoid Biosynthesis Pathway (106152)
ncbi summary :
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has steroid 18-hydroxylase activity to synthesize aldosterone and 18-oxocortisol as well as steroid 11 beta-hydroxylase activity. Mutations in this gene cause corticosterone methyl oxidase deficiency. [provided by RefSeq, Jul 2008]
uniprot summary :
CYP11B2: Preferentially catalyzes the conversion of 11- deoxycorticosterone to aldosterone via corticosterone and 18- hydroxycorticosterone. Defects in CYP11B2 are the cause of corticosterone methyloxidase type 1 deficiency (CMO-1 deficiency); also known as aldosterone deficiency due to defect in 18- hydroxylase or aldosterone deficiency I. CMO-1 deficiency is an autosomal recessive disorder of aldosterone biosynthesis. There are two biochemically different forms of selective aldosterone deficiency be termed corticosterone methyloxidase (CMO) deficiency type 1 and type 2. In CMO-1 deficiency, aldosterone is undetectable in plasma, while its immediate precursor, 18- hydroxycorticosterone, is low or normal. Defects in CYP11B2 are the cause of corticosterone methyloxidase type 2 deficiency (CMO-2 deficiency). CMO-2 is an autosomal recessive disorder of aldosterone biosynthesis. In CMO-2 deficiency, aldosterone can be low or normal, but at the expense of increased secretion of 18- hydroxycorticosterone. Consequently, patients have a greatly increased ratio of 18-hydroxycorticosterone to aldosterone and a low ratio of corticosterone to 18-hydroxycorticosterone in serum. Defects in CYP11B2 are a cause of familial hyperaldosteronism type 1 (FH1). It is a disorder characterized by hypertension, variable hyperaldosteronism, and abnormal adrenal steroid production, including 18-oxocortisol and 18-hydroxycortisol. There is significant phenotypic heterogeneity, and some individuals never develop hypertension. The molecular defect causing hyperaldosteronism familial type 1 is an anti-Lepore-type fusion of the CYP11B1 and CYP11B2 genes. The hybrid gene has the promoting part of CYP11B1, ACTH-sensitive, and the coding part of CYP11B2. Belongs to the cytochrome P450 family. Protein type: Lipid Metabolism - androgen and estrogen; EC 1.14.15.5; Lipid Metabolism - C21-steroid hormone; Mitochondrial; Oxidoreductase; EC 1.14.15.4. Chromosomal Location of Human Ortholog: 8q21-q22. Cellular Component: mitochondrion; mitochondrial inner membrane. Molecular Function: corticosterone 18-monooxygenase activity; steroid 11-beta-monooxygenase activity; iron ion binding; heme binding. Biological Process: steroid metabolic process; xenobiotic metabolic process; mineralocorticoid biosynthetic process; C21-steroid hormone biosynthetic process; renal water homeostasis; aldosterone mediated regulation of blood volume; sodium ion homeostasis; potassium ion homeostasis; sterol metabolic process; aldosterone biosynthetic process; cellular response to hormone stimulus. Disease: Corticosterone Methyloxidase Type Ii Deficiency; Corticosterone Methyloxidase Type I Deficiency